bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-28_CDS_annotation_glimmer3.pl_2_1 Length=162 Score E Sequences producing significant alignments: (Bits) Value 525263.HMPREF0298_0889 38.5 0.37 > 525263.HMPREF0298_0889 Length=1116 Score = 38.5 bits (88), Expect = 0.37, Method: Compositional matrix adjust. Identities = 24/91 (26%), Positives = 47/91 (52%), Gaps = 3/91 (3%) Query 38 LVEKGEENLYEYIQSYKDSVDINTLLRRYAQGDPDALSRVQAAYGDFTGLPSTYADLLNA 97 + ++G +L QS K D+N L+R + +P+ + + A G+FT L + Y+ +++A Sbjct 197 ITDEGALDLLHRTQSAKTLGDLNHLMRTFMLPEPETFAIAEQAAGNFTDLHTAYSSVVDA 256 Query 98 VNDGKQYFESLPVDVRAQFNHSFSEFMASMD 128 +Q LPV V A+ + + ++D Sbjct 257 ---REQIEHLLPVRVAAEKRSDVATELLTVD 284 Lambda K H a alpha 0.317 0.134 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128033376900