bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-20_CDS_annotation_glimmer3.pl_2_1 Length=76 Score E Sequences producing significant alignments: (Bits) Value 760142.Hipma_1281 32.3 7.3 > 760142.Hipma_1281 Length=311 Score = 32.3 bits (72), Expect = 7.3, Method: Compositional matrix adjust. Identities = 20/70 (29%), Positives = 33/70 (47%), Gaps = 8/70 (11%) Query 1 MNFNEVFKVRTVKKNEEDTYVITIGNRLASEEEFKTAQKAQMKINKTDW---NLVASLFA 57 ++ E+ V K E+TY+I I L F+ Q+ NKT + L ++ Sbjct 21 IHVGEIIDAEVVSKKSENTYIIKIKGEL-----FEATSNTQLPTNKTKFVVKQLSPTIIL 75 Query 58 AMLEGEKKQQ 67 +L+GEK Q+ Sbjct 76 KILDGEKPQE 85 Lambda K H a alpha 0.308 0.123 0.320 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127989974020