bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_1 Length=224 Score E Sequences producing significant alignments: (Bits) Value 313606.M23134_03211 37.7 2.2 > 313606.M23134_03211 Length=1336 Score = 37.7 bits (86), Expect = 2.2, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 0/45 (0%) Query 14 VIFLVRTANYLLNVCVSIYLNLLENMKKYISTLYQNTDPYTSVRI 58 VI LV + NV + +LNLL N+ YI+ QNTD YT + + Sbjct 1017 VIGLVSVQSLQSNVYTNYHLNLLRNLAVYITIALQNTDSYTKIEL 1061 Lambda K H a alpha 0.326 0.139 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 280734864300