bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-4_CDS_annotation_glimmer3.pl_2_1 Length=128 Score E Sequences producing significant alignments: (Bits) Value gi|670193840|gb|KFE56331.1| DSBA oxidoreductase 37.7 1.0 gi|520786191|ref|WP_020290084.1| DSBA oxidoreductase 37.7 1.1 gi|502128560|ref|WP_012715908.1| hypothetical protein 35.0 3.0 gi|497360765|ref|WP_009674978.1| MULTISPECIES: hypothetical protein 36.2 3.4 gi|654511334|ref|WP_027980638.1| amidohydrolase 36.2 3.4 gi|587932686|gb|EXC19717.1| F-box/kelch-repeat protein SKIP6 35.0 8.1 >gi|670193840|gb|KFE56331.1| DSBA oxidoreductase [Pseudomonas syringae] Length=214 Score = 37.7 bits (86), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/65 (34%), Positives = 32/65 (49%), Gaps = 6/65 (9%) Query 16 LNWDVPIGKISRFFYRFNRF------EAMKGSLRSKLKAVSLFYDYRDYQSLKNQLSLQE 69 LN D+PI + R YR +F +AM + KAV L +DY+ + N L+ Sbjct 48 LNPDMPISGMDRKAYRSGKFGSWARSQAMDAQVAHAGKAVGLEFDYKRVEKTPNTLAAHR 107 Query 70 LVFAE 74 LV+ E Sbjct 108 LVWRE 112 >gi|520786191|ref|WP_020290084.1| DSBA oxidoreductase [Pseudomonas sp. CFII64] gi|515439387|gb|EPJ87575.1| DSBA oxidoreductase [Pseudomonas sp. CFII64] Length=275 Score = 37.7 bits (86), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/65 (34%), Positives = 32/65 (49%), Gaps = 6/65 (9%) Query 16 LNWDVPIGKISRFFYRFNRF------EAMKGSLRSKLKAVSLFYDYRDYQSLKNQLSLQE 69 LN D+PI + R YR +F +AM + KAV L +DY+ + N L+ Sbjct 109 LNPDMPISGMDRKAYRSGKFGSWARSQAMDAQVAHAGKAVGLEFDYKRVEKTPNTLAAHR 168 Query 70 LVFAE 74 LV+ E Sbjct 169 LVWRE 173 >gi|502128560|ref|WP_012715908.1| hypothetical protein [Sulfolobus islandicus] gi|229578648|ref|YP_002837046.1| hypothetical protein YG5714_0844 [Sulfolobus islandicus Y.G.57.14] gi|228009362|gb|ACP45124.1| hypothetical protein YG5714_0844 [Sulfolobus islandicus Y.G.57.14] Length=93 Score = 35.0 bits (79), Expect = 3.0, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 4/55 (7%) Query 61 LKNQLSLQELVFAELGYSDELFDSFYVKPHIKVLKNAYIDKWKDVNYKEVHYFRV 115 + +L L EL AE+ YS+E VK + K +K +DKW+ VN+ YFR Sbjct 40 IAEELKLNEL-KAEITYSEEATTYVEVKLYKKAIKGTLLDKWRRVNF---SYFRC 90 >gi|497360765|ref|WP_009674978.1| MULTISPECIES: hypothetical protein [Paenibacillus] gi|333605206|gb|EGL16577.1| hypothetical protein HMPREF9413_5826 [Paenibacillus sp. HGF7] gi|512139813|gb|EPD82394.1| hypothetical protein HMPREF1207_04221 [Paenibacillus sp. HGH0039] Length=266 Score = 36.2 bits (82), Expect = 3.4, Method: Compositional matrix adjust. Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 11/90 (12%) Query 19 DVPIGKISRFF--YRFNRFEAMKGSLRSKLKAVSLFYDYRDYQSLKNQLSLQELVFAELG 76 DVP+ K FF Y+ N ++M G + L A+ LF YR Y L + LSL +F +G Sbjct 85 DVPLFK--TFFRGYKENFLQSMIGGIAFVLFALILFVSYRFYAGLDSALSLLSYMFLAMG 142 Query 77 --YSDELFDSFYVKPH-----IKVLKNAYI 99 F+ F + H ++++KNA + Sbjct 143 ILLIGAFFNFFCIMSHLHMKVLQIIKNAIL 172 >gi|654511334|ref|WP_027980638.1| amidohydrolase [gamma proteobacterium L18] Length=279 Score = 36.2 bits (82), Expect = 3.4, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 4/59 (7%) Query 36 EAMKGSLRSKLKAVSLFYDYRDYQSLKNQLSLQELVFAELGYSDELFDSFYVKPHIKVL 94 EA+K +R +LK +F DY S+ ++ +E + ELGYSDE+ ++F+ K +VL Sbjct 223 EALKRDMRGRLKDKVMFGS--DYPSIPHERLFKE--WGELGYSDEMLEAFFHKNAERVL 277 >gi|587932686|gb|EXC19717.1| F-box/kelch-repeat protein SKIP6 [Morus notabilis] Length=392 Score = 35.0 bits (79), Expect = 8.1, Method: Composition-based stats. Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 5/74 (7%) Query 6 HIVRLDGYSFLNWDVPIGKISRFFYRFNRFEAMKGSLRSKLKAVSLFYDYRDYQSLKNQL 65 +I +DG S+ ++ +GKI RF R ++ +KG K + Y Y D Q+L N Sbjct 259 NICVVDGVSYTSFGNNVGKIERFDERIGVWKELKGVEEGKPE-----YVYGDVQTLINLD 313 Query 66 SLQELVFAELGYSD 79 +VFAE+ + D Sbjct 314 GRLVVVFAEMRFED 327 Lambda K H a alpha 0.326 0.142 0.430 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 440512404018