bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_7 Length=84 Score E Sequences producing significant alignments: (Bits) Value gi|398411682|ref|XP_003857179.1| hypothetical protein MYCGRDRAFT... 33.5 9.4 >gi|398411682|ref|XP_003857179.1| hypothetical protein MYCGRDRAFT_102682 [Zymoseptoria tritici IPO323] gi|339477064|gb|EGP92155.1| hypothetical protein MYCGRDRAFT_102682 [Zymoseptoria tritici IPO323] Length=171 Score = 33.5 bits (75), Expect = 9.4, Method: Compositional matrix adjust. Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%) Query 51 KSHPILSLAQAKAKTDCDNRVKHREINERNL 81 KS S+AQ +KTD DN V HRE NE +L Sbjct 23 KSASEQSMAQLNSKTDADNAVAHREANEPHL 53 Lambda K H a alpha 0.315 0.129 0.369 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 431162850036