bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-38_CDS_annotation_glimmer3.pl_2_4 Length=65 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_C_029_Microviridae_AG0110_hypothetical.... 48.5 5e-11 Alpavirinae_Human_feces_B_020_Microviridae_AG0354_hypothetical.... 41.2 3e-08 Alpavirinae_Human_feces_A_048_Microviridae_AG088_hypothetical.p... 38.5 2e-07 Gokush_gi|47566141|ref|YP_022479.1|_structural_protein_[Chlamyd... 22.7 0.29 Alpavirinae_Human_feces_C_010_Microviridae_AG0197_hypothetical.... 19.2 5.2 > Alpavirinae_Human_feces_C_029_Microviridae_AG0110_hypothetical.protein Length=54 Score = 48.5 bits (114), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%) Query 9 MGVGVEEKGYELTNDEILKEYELIKQERRLLCRKIYDKEENDKKESGKRQLKLF 62 M G +G+E+ D ++KEY L ++ER+L+C K YDK+ D K+ +QLKLF Sbjct 1 MKPGEVTQGFEIFEDTVIKEYNLNRKERKLICEKTYDKDLEDLKKWNHKQLKLF 54 > Alpavirinae_Human_feces_B_020_Microviridae_AG0354_hypothetical.protein Length=80 Score = 41.2 bits (95), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 0/64 (0%) Query 1 MKTYAYFNMGVGVEEKGYELTNDEILKEYELIKQERRLLCRKIYDKEENDKKESGKRQLK 60 K + + N+ G +G+++ D I K Y + K ERRLL YD E++ K+ QL Sbjct 13 FKRWLWHNLHTGETLEGFQIWEDTIFKSYNIKKTERRLLVEITYDLEKSQKEYFENLQLN 72 Query 61 LFND 64 LF++ Sbjct 73 LFDN 76 > Alpavirinae_Human_feces_A_048_Microviridae_AG088_hypothetical.protein Length=54 Score = 38.5 bits (88), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 21/54 (39%), Positives = 34/54 (63%), Gaps = 0/54 (0%) Query 9 MGVGVEEKGYELTNDEILKEYELIKQERRLLCRKIYDKEENDKKESGKRQLKLF 62 M G G+E+ D I+KEY L ++ERRL+ K YD++++ + +QLKL+ Sbjct 1 MIPGECTNGFEIFEDTIIKEYNLNRKERRLIIEKTYDEQKDLLRHVLNQQLKLW 54 > Gokush_gi|47566141|ref|YP_022479.1|_structural_protein_[Chlamydia_phage_3] Length=565 Score = 22.7 bits (47), Expect = 0.29, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query 8 NMGVGVEEKGYELTNDEILKEYELIKQERR 37 N+ VE + + T DE+ K YEL+K+ +R Sbjct 164 NIQESVEVQMGDTTTDEV-KNYELLKRGKR 192 > Alpavirinae_Human_feces_C_010_Microviridae_AG0197_hypothetical.protein.BACPLE Length=382 Score = 19.2 bits (38), Expect = 5.2, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 9/45 (20%) Query 13 VEEKGYELTNDEILKEYELIKQERRLLCRKIYDKEENDKKESGKR 57 ++E +L D L+ E LLC+K Y D KES R Sbjct 233 IDENIVQLKFDRYLRSNEF-----ELLCKKTY----QDMKESNSR 268 Lambda K H a alpha 0.313 0.137 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3675489