bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-15_CDS_annotation_glimmer3.pl_2_5 Length=57 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_A_021_Microviridae_AG076_hypothetical.p... 47.4 9e-11 Alpavirinae_Human_feces_C_016_Microviridae_AG0275_hypothetical.... 18.9 5.5 Alpavirinae_Human_feces_B_039_Microviridae_AG096_putative.VP1 18.1 9.9 > Alpavirinae_Human_feces_A_021_Microviridae_AG076_hypothetical.protein Length=52 Score = 47.4 bits (111), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 0/48 (0%) Query 5 YLCSIQSKLNPSQCETVLVPVDEVSDFVSSNLRPDCILIFSQCSTFKA 52 +L +I SK +P V V +VSDF+S NL PD +++FS C+ + A Sbjct 2 FLATISSKFDPKDQRAVFVNSSDVSDFLSDNLTPDVVIVFSYCTGYDA 49 > Alpavirinae_Human_feces_C_016_Microviridae_AG0275_hypothetical.protein.HMPREF9141.0987 Length=335 Score = 18.9 bits (37), Expect = 5.5, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (55%), Gaps = 0/31 (0%) Query 22 LVPVDEVSDFVSSNLRPDCILIFSQCSTFKA 52 L+ EVS+ + NL+ LI +Q + KA Sbjct 197 LIADKEVSEEMRRNLQKQRDLIVAQIDSTKA 227 > Alpavirinae_Human_feces_B_039_Microviridae_AG096_putative.VP1 Length=579 Score = 18.1 bits (35), Expect = 9.9, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 11/18 (61%), Gaps = 1/18 (6%) Query 8 SIQS-KLNPSQCETVLVP 24 S QS K+ P Q ++ VP Sbjct 527 SYQSMKIRPQQLNSIFVP 544 Lambda K H a alpha 0.320 0.132 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3661448