bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-8_CDS_annotation_glimmer3.pl_2_4 Length=156 Score E Sequences producing significant alignments: (Bits) Value pcs:Pc20g02150 Pc20g02150 37.4 0.86 cmk:103184144 tenm2; teneurin transmembrane protein 2 37.0 cten:CANTEDRAFT_112400 MFS general substrate transporter 35.0 5.9 ptq:P700755_000839 lysyl-tRNA synthetase (class II) LysS 34.7 7.9 > pcs:Pc20g02150 Pc20g02150 Length=551 Score = 37.4 bits (85), Expect = 0.86, Method: Compositional matrix adjust. Identities = 26/77 (34%), Positives = 42/77 (55%), Gaps = 8/77 (10%) Query 40 ADSDGVLHVLNDISLL------FNQQRLENRLSSTELREMFNRYSPNKSRYLAQLDDDTL 93 A D LH +++SL F+++ L+ L EL E+ R+ ++R+LA D Sbjct 227 AHEDVPLHASDEVSLPRLEIPRFSKEELQRSLDDPELSELHERHQMERNRHLA--FHDAA 284 Query 94 LSTLKSRHIQSLSEIKS 110 LSTL+ RH ++SE +S Sbjct 285 LSTLRRRHQTAVSEHQS 301 > cmk:103184144 tenm2; teneurin transmembrane protein 2 Length=2757 Score = 37.0 bits (84), Expect = 1.5, Method: Compositional matrix adjust. Identities = 40/137 (29%), Positives = 65/137 (47%), Gaps = 14/137 (10%) Query 1 MSRKVKKERYSSRLSYNYDY--DSKKSKFVVRDKLAVLSSYADSDGVLHVLND---ISLL 55 + R++K Y++ YNYDY D + V DK SY D +G LH+LN I L+ Sbjct 2169 IKREIKVGPYANTTKYNYDYDGDGQLQTVTVNDKATWRYSY-DLNGNLHLLNPGSSIRLM 2227 Query 56 FNQQRLENRLSSTELREMFNRYSPNKSRYLAQLDDDTLLSTLKSRHIQSLSEIKSW-TEY 114 + L +R+ T L ++ +Y ++ L+Q D KS I+ S++ W +Y Sbjct 2228 PLRYDLRDRI--TRLGDV--QYKLDEDGLLSQRGSDVFEYNSKSLLIRVYSKVNGWNVQY 2283 Query 115 CIENFDSLLKAQQAKEN 131 +D L + +K N Sbjct 2284 ---RYDGLARRVSSKTN 2297 > cten:CANTEDRAFT_112400 MFS general substrate transporter Length=470 Score = 35.0 bits (79), Expect = 5.9, Method: Composition-based stats. Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 2/44 (5%) Query 7 KERYSSRLSYNYDYDSKKSKFV-VRDKLAVLSSYADSDGVLHVL 49 KER++ +S N DYDSK+ KFV V KL L+S DS + VL Sbjct 243 KERFTKSVS-NDDYDSKRHKFVGVSKKLFNLNSLTDSKFIFLVL 285 > ptq:P700755_000839 lysyl-tRNA synthetase (class II) LysS Length=563 Score = 34.7 bits (78), Expect = 7.9, Method: Composition-based stats. Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 11/141 (8%) Query 6 KKERYSSRLSYNYDYDSKKSKFVVRDKLAVLSSYADSDGVLHVLNDISLLFNQQRLENRL 65 ++ER+ ++ + D + ++F+ D L L L + D ++F L N Sbjct 428 QRERFEDQMKLSQKGDDEATEFIDYDFLRALEYGMPPTSGLGIGMDRLIMF----LTNNP 483 Query 66 SSTELREMFNRYSPNKSRYLAQLDDDTLLSTLKSRHIQSLSEIKSWTEYCIENFDSLLKA 125 S E+ F + P K + ++ ++ LK Q+L EIKS +E + +D +K Sbjct 484 SIQEVL-FFPQMRPEKKKVELTEEEKVVIDLLKVTSPQALEEIKSKSELSNKKWDKAIKG 542 Query 126 QQAKENEIDDIQETVDEPSAG 146 ++K+ Q TVD+ + G Sbjct 543 LRSKD------QATVDKTNEG 557 Lambda K H a alpha 0.310 0.126 0.336 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126812206336