bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-8_CDS_annotation_glimmer3.pl_2_1 Length=461 Score E Sequences producing significant alignments: (Bits) Value mdm:103449147 ARF guanine-nucleotide exchange factor GNL2-like 39.7 1.7 clp:CPK_ORF00729 hypothetical protein 36.6 2.4 bfu:BC1G_05882 hypothetical protein 38.5 3.0 siy:YG5714_0844 hypothetical protein 35.4 5.0 caa:Caka_1841 TetR family transcriptional regulator 36.6 6.7 > mdm:103449147 ARF guanine-nucleotide exchange factor GNL2-like Length=1384 Score = 39.7 bits (91), Expect = 1.7, Method: Composition-based stats. Identities = 28/86 (33%), Positives = 40/86 (47%), Gaps = 22/86 (26%) Query 57 SIPRVSKLQNFKDEYFEELVWMLPEIAESLKKKNNTDASGAFPQFKGLLKYVNIRDYQLF 116 S P S L + + FE LV M+ IA+S+ K+N+T SG +P + IR+Y F Sbjct 428 SFPVASPLTTLQIQAFEGLVIMIHNIADSIDKENDTSPSGPYP--------IEIREYTPF 479 Query 117 AK--------------RLRKYLSKKI 128 + RLRK +KI Sbjct 480 WEDKPKDDSEAWVQFVRLRKAQKRKI 505 > clp:CPK_ORF00729 hypothetical protein Length=121 Score = 36.6 bits (83), Expect = 2.4, Method: Compositional matrix adjust. Identities = 33/90 (37%), Positives = 42/90 (47%), Gaps = 15/90 (17%) Query 76 VWMLPEIAE-SLKKKNN----TDASGAFPQFKGLLKYVNIRDYQLFAKRLRKYLSKKIGK 130 VW + E SL +KN T PQ+ L+K QLF KRLR +S Sbjct 37 VWSYRCVHEASLYEKNCFLTLTYDDKHLPQYGSLVKL----HLQLFLKRLRDRISP---- 88 Query 131 YEKIHSYVVSEYSPKTFRPHFHILFF-FDS 159 KI + EY K RPH+H+L F +DS Sbjct 89 -HKIRYFGCGEYGTKLQRPHYHLLIFNYDS 117 > bfu:BC1G_05882 hypothetical protein Length=506 Score = 38.5 bits (88), Expect = 3.0, Method: Compositional matrix adjust. Identities = 28/91 (31%), Positives = 47/91 (52%), Gaps = 11/91 (12%) Query 7 VNKNIPDFMSAKVNRPYMLEHLRLLEADRYKALALRYPNFISKFRPFILRSIPRVSKLQN 66 ++ IP MS +PY + H L AD Y+ LA RYP+ K+ I R + Sbjct 43 MSNKIP-LMSDVEEKPYCIWHPHLATADTYRELAQRYPDM--KYH------IGRACAVGG 93 Query 67 FKDEYFEELVWMLPEIAESLKKKNNTDASGA 97 + D Y E + +LP+I+ + + +N+D +G+ Sbjct 94 YIDLYRE--LDLLPDISIAEEAWHNSDVTGS 122 > siy:YG5714_0844 hypothetical protein Length=93 Score = 35.4 bits (80), Expect = 5.0, Method: Composition-based stats. Identities = 21/54 (39%), Positives = 30/54 (56%), Gaps = 4/54 (7%) Query 394 LKNQLSLQELVFAELGYSDELFDSFYVKPHIKVLKNAYIDKWKDVNYKEVHYFR 447 + +L L EL AE+ YS+E VK + K +K +DKW+ VN+ YFR Sbjct 40 IAEELKLNELK-AEITYSEEATTYVEVKLYKKAIKGTLLDKWRRVNFS---YFR 89 > caa:Caka_1841 TetR family transcriptional regulator Length=193 Score = 36.6 bits (83), Expect = 6.7, Method: Compositional matrix adjust. Identities = 20/78 (26%), Positives = 39/78 (50%), Gaps = 3/78 (4%) Query 98 FPQFKGLLKYVNIRDYQLFAKRLRKYLSKKIGKYEKIHSYVVSEYSPKTFRPHFHILFF- 156 F +GL+ +N Q AKR+ + ++IH++ S +T P L F Sbjct 52 FDNLEGLIVAINTHSAQQLAKRIGRIHESGHSAEQRIHAFCRSYLDFQTDEPELWKLLFA 111 Query 157 --FDSDEIAKNFRQAVYQ 172 ++D+++++FR AV++ Sbjct 112 APINNDKLSQDFRDAVHK 129 Lambda K H a alpha 0.325 0.140 0.424 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 981216274224