bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-7_CDS_annotation_glimmer3.pl_2_3 Length=44 Score E Sequences producing significant alignments: (Bits) Value dge:Dgeo_2264 nitrilase/cyanide hydratase and apolipoprotein N... 31.2 7.9 > dge:Dgeo_2264 nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase Length=306 Score = 31.2 bits (69), Expect = 7.9, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (59%), Gaps = 1/34 (3%) Query 8 PIFGVVADGSWNTDQLLVNCDFDVRVARNLSYDG 41 P G+VA+G WNT LV D D+ + R + DG Sbjct 245 PETGIVAEGEWNTPGWLVT-DLDLELIRRVREDG 277 Lambda K H a alpha 0.321 0.141 0.452 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126506741218