bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-3_CDS_annotation_glimmer3.pl_2_6 Length=62 Score E Sequences producing significant alignments: (Bits) Value ssl:SS1G_02526 hypothetical protein 32.3 5.7 > ssl:SS1G_02526 hypothetical protein Length=329 Score = 32.3 bits (72), Expect = 5.7, Method: Composition-based stats. Identities = 15/35 (43%), Positives = 17/35 (49%), Gaps = 0/35 (0%) Query 22 LCCLVGEFLCTGDKVLIFQSVTEYKATPCETDPCV 56 LCC FL G+ L F SV Y+ T PCV Sbjct 113 LCCFFAGFLILGNLSLAFNSVGFYQLAKIMTTPCV 147 Lambda K H a alpha 0.316 0.136 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 129858300684