bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_1 Length=54 Score E Sequences producing significant alignments: (Bits) Value alt:ambt_14960 hypothetical protein 33.1 2.6 csu:CSUB_C0037 hypothetical protein 31.6 10.0 > alt:ambt_14960 hypothetical protein Length=568 Score = 33.1 bits (74), Expect = 2.6, Method: Composition-based stats. Identities = 17/52 (33%), Positives = 31/52 (60%), Gaps = 4/52 (8%) Query 3 ATFVIGVITTLFVHSCTLSLSVAKNNTNSTQKTEQT----STSSVDSTRINI 50 +T + V T+LF+ +C+ + A + N+T+K QT ST V+ +R++I Sbjct 9 STLAVAVATSLFMSACSKAPEEAVSQANTTEKASQTVLPDSTLLVNESRLSI 60 > csu:CSUB_C0037 hypothetical protein Length=486 Score = 31.6 bits (70), Expect = 10.0, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 2/54 (4%) Query 1 LIATFVIGVI-TTLFVHSCTLSLSVAKNNTNSTQKTEQTSTSSVDSTRININSK 53 +I+ V+GV+ TT F+H T ++ K T T QT+ S TR+N+ +K Sbjct 10 VISLLVVGVLATTTFLHPSTHQITSVKPGETDTHTTVQTAMSP-SMTRLNLIAK 62 Lambda K H a alpha 0.311 0.120 0.308 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127911952116