bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-22_CDS_annotation_glimmer3.pl_2_2 Length=91 Score E Sequences producing significant alignments: (Bits) Value 665938.HMPREF1018_03647 85.9 1e-19 > 665938.HMPREF1018_03647 Length=131 Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 43/88 (49%), Positives = 63/88 (72%), Gaps = 2/88 (2%) Query 1 LRDAFGKPICINSGYRSNFVNEAVGGVSNSQHKFGYAADISVSSRDSISELFALIQKMEL 60 LR+ +GKPI I+SGYRS +N +V G ++SQH+ G AADI+V S++ +LF +IQ +EL Sbjct 43 LREKYGKPIRISSGYRSAILNRSVNGATSSQHRVGEAADITVGSKEENRKLFEIIQ-LEL 101 Query 61 PFDQVIYYRKAGFIHVSWSP-TYRKQII 87 PFDQ+I R ++HVS+ RKQ++ Sbjct 102 PFDQLIDERDFSWVHVSFREGRNRKQVL 129 Lambda K H a alpha 0.323 0.138 0.408 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126155698800