bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-18_CDS_annotation_glimmer3.pl_2_6 Length=109 Score E Sequences producing significant alignments: (Bits) Value 396588.Tgr7_2914 35.0 1.7 > 396588.Tgr7_2914 Length=426 Score = 35.0 bits (79), Expect = 1.7, Method: Composition-based stats. Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (3%) Query 31 VVAHPMSYYLN--GGVDLQGISTRKPLPAAFDDAESIASGDVNVFTDPTVGKLDLMDMAS 88 V HP+ + LN G V + TR LP AE+ A G + T+ T ++ L +++ Sbjct 177 VYLHPIDWSLNAKGCVHEGPVGTRLGLPGIPAAAETAALGTILALTEQTGARVHLCRLST 236 Query 89 TMASESEARALKDG 102 A++ ARA DG Sbjct 237 ARAAQMLARARHDG 250 Lambda K H a alpha 0.312 0.129 0.365 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126949807360