bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-21_CDS_annotation_glimmer3.pl_2_1 Length=82 Score E Sequences producing significant alignments: (Bits) Value gi|575094326|emb|CDL65712.1| unnamed protein product 89.7 9e-19 gi|649569140|gb|KDS75238.1| capsid family protein 39.3 0.16 gi|575094339|emb|CDL65730.1| unnamed protein product 38.9 0.25 gi|649555287|gb|KDS61824.1| capsid family protein 37.7 0.51 gi|666669584|dbj|BAP16753.1| P0 protein 35.4 1.9 gi|575094603|emb|CDL65960.1| unnamed protein product 35.0 3.6 gi|488373399|ref|WP_002442784.1| oligoendopeptidase F 34.3 6.0 gi|444297972|dbj|GAC77853.1| major capsid protein 33.9 7.9 gi|159124074|gb|EDP49193.1| hypothetical protein AFUB_086410 33.9 8.5 gi|470147427|ref|XP_004309312.1| PREDICTED: capsid protein VP1-like 33.9 9.4 >gi|575094326|emb|CDL65712.1| unnamed protein product [uncultured bacterium] Length=758 Score = 89.7 bits (221), Expect = 9e-19, Method: Composition-based stats. Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 2/77 (3%) Query 1 LLAYRFRAYEAVYNAYYRDIRNNPFVVNGRPVYNKWLATMKGGADK-TPYELHQCNWERD 59 L AY FRAYEA+YNAY R+ RNNPFV+NG+ YN+W+ T GG+D TP +L NW+ D Sbjct 360 LSAYPFRAYEAIYNAYIRNTRNNPFVLNGKKTYNRWITTDAGGSDTLTPRDLRFANWQSD 419 Query 60 FLTTAVPNPQQSANAPL 76 TTA+ PQQ APL Sbjct 420 AYTTALTAPQQGV-APL 435 >gi|649569140|gb|KDS75238.1| capsid family protein, partial [Parabacteroides distasonis str. 3999B T(B) 6] Length=390 Score = 39.3 bits (90), Expect = 0.16, Method: Composition-based stats. Identities = 23/73 (32%), Positives = 38/73 (52%), Gaps = 15/73 (21%) Query 3 AYRFRAYEAVYNAYYRDIRNNPFVVNGRPVYNKWLATMKGGADKTP-----YELHQCNWE 57 A FRAY +YN YYRD + + ++ T+ G + P ++LH+ WE Sbjct 9 ALPFRAYHLIYNEYYRD----------QNLTSELEITLDSGNYQLPVNSSLWQLHRRAWE 58 Query 58 RDFLTTAVPNPQQ 70 +D+ T+A+P Q+ Sbjct 59 KDYFTSALPWVQR 71 >gi|575094339|emb|CDL65730.1| unnamed protein product [uncultured bacterium] Length=588 Score = 38.9 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 20/69 (29%), Positives = 35/69 (51%), Gaps = 3/69 (4%) Query 4 YRFRAYEAVYNAYYRDIRNNPFVVNGRPVYNKWLATMKGGADKTPYELHQCNWERDFLTT 63 + F AY+ ++N +YR + + YN A + D + +ELH W++D+ T Sbjct 180 FLFTAYQKIFNDFYR---LDDYTSVQHKSYNVDYAQGQPITDNSMFELHYRPWKKDYFTN 236 Query 64 AVPNPQQSA 72 +PNP S+ Sbjct 237 VIPNPYFSS 245 >gi|649555287|gb|KDS61824.1| capsid family protein [Parabacteroides distasonis str. 3999B T(B) 4] gi|649560568|gb|KDS66876.1| capsid family protein [Parabacteroides distasonis str. 3999B T(B) 4] gi|649561020|gb|KDS67307.1| capsid family protein [Parabacteroides distasonis str. 3999B T(B) 4] gi|649562724|gb|KDS68908.1| capsid family protein [Parabacteroides distasonis str. 3999B T(B) 6] Length=541 Score = 37.7 bits (86), Expect = 0.51, Method: Compositional matrix adjust. Identities = 22/69 (32%), Positives = 36/69 (52%), Gaps = 15/69 (22%) Query 3 AYRFRAYEAVYNAYYRDIRNNPFVVNGRPVYNKWLATMKGGADKTP-----YELHQCNWE 57 A FRAY +YN YYRD + + ++ T+ G + P ++LH+ WE Sbjct 160 ALPFRAYHLIYNEYYRD----------QNLTSELEITLDSGNYQLPVNSSLWQLHRRAWE 209 Query 58 RDFLTTAVP 66 +D+ T+A+P Sbjct 210 KDYFTSALP 218 >gi|666669584|dbj|BAP16753.1| P0 protein [Beet western yellows virus] Length=238 Score = 35.4 bits (80), Expect = 1.9, Method: Compositional matrix adjust. Identities = 14/44 (32%), Positives = 27/44 (61%), Gaps = 0/44 (0%) Query 18 RDIRNNPFVVNGRPVYNKWLATMKGGADKTPYELHQCNWERDFL 61 R I++ + G+ ++K+L+ GA++ ++H+ N ERDFL Sbjct 120 RIIKHQDLLARGKREFDKFLSVWCAGAERNLSQIHKTNIERDFL 163 >gi|575094603|emb|CDL65960.1| unnamed protein product [uncultured bacterium] Length=507 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 20/69 (29%), Positives = 32/69 (46%), Gaps = 11/69 (16%) Query 7 RAYEAVYNAYYRDIRNNPFVVNGRPVYNKWLATMKGGADKT-PYELHQCNWERDFLTTAV 65 RAY +YN Y+RD + + + + + G D T P L + +W +D+ T A Sbjct 128 RAYALIYNEYFRD----------QDIDEELPISFESGQDTTTPSVLQRADWRKDYFTLAR 177 Query 66 PNPQQSANA 74 P Q+ A Sbjct 178 PFEQKGPAA 186 >gi|488373399|ref|WP_002442784.1| oligoendopeptidase F [Staphylococcus caprae] gi|242348647|gb|EES40249.1| oligoendopeptidase F [Staphylococcus caprae M23864:W1] Length=602 Score = 34.3 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 5/53 (9%) Query 1 LLAYRFRAYEAVYNAYYRDIRNNPFVVNGRPVYNKWLATMKGGADKTPYELHQ 53 L +Y + A + + I+N G+P ++WL T+K G K+P EL Q Sbjct 519 LYSYTYSAGLTIGTVVSQKIKNE-----GQPAVDQWLETLKAGGSKSPVELAQ 566 >gi|444297972|dbj|GAC77853.1| major capsid protein [uncultured marine virus] Length=529 Score = 33.9 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 35/73 (48%), Gaps = 13/73 (18%) Query 6 FRAYEAVYNAYYR--DIRNNPFVVNGRPVYNKWLATMKGGADKTPYELHQCNWERDFLTT 63 FRAY ++N ++R D++N+ V T G D T Y L + D+ T+ Sbjct 151 FRAYNLIWNEWFRSEDLQNSIVV-----------DTDNGPDDITDYVLKERGKRHDYFTS 199 Query 64 AVPNPQQSANAPL 76 A+P PQ+ + L Sbjct 200 ALPWPQKGTSVSL 212 >gi|159124074|gb|EDP49193.1| hypothetical protein AFUB_086410 [Aspergillus fumigatus A1163] Length=490 Score = 33.9 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query 31 PVYNKWLATMKG-GADK-TPYELHQCNWERDFLTTAVPNPQQSANAPLC 77 P+ K L M+G GAD PY+ Q +W DFL + +P+Q N +C Sbjct 108 PLEEKLLRWMEGLGADVLRPYKFVQGSWRPDFLLESSEDPEQIENYRIC 156 >gi|470147427|ref|XP_004309312.1| PREDICTED: capsid protein VP1-like, partial [Fragaria vesca subsp. vesca] Length=421 Score = 33.9 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 23/73 (32%), Positives = 34/73 (47%), Gaps = 17/73 (23%) Query 7 RAYEAVYNAYYRD--IRNNPFVVNGRPVYNKWLATMKGGADKTP---YELHQCNWERDFL 61 RAY +YN ++RD ++N+ V G G D TP Y L + D+ Sbjct 181 RAYNLIYNQWFRDENLQNSVVVDKG------------DGPDTTPSTNYTLLRRGKRHDYF 228 Query 62 TTAVPNPQQSANA 74 T+A+P PQ+ A Sbjct 229 TSALPWPQKGGTA 241 Lambda K H a alpha 0.323 0.136 0.468 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 434005500390