bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-18_CDS_annotation_glimmer3.pl_2_6 Length=109 Score E Sequences producing significant alignments: (Bits) Value gi|501784240|ref|WP_012639450.1| dihydroorotase 35.0 5.8 gi|502275071|ref|WP_012749042.1| glycine betain transporter subs... 35.0 6.4 >gi|501784240|ref|WP_012639450.1| dihydroorotase [Thioalkalivibrio sulfidiphilus] gi|220936075|ref|YP_002514974.1| dihydroorotase [Thioalkalivibrio sulfidiphilus HL-EbGr7] gi|219997385|gb|ACL73987.1| dihydroorotase, multifunctional complex type [Thioalkalivibrio sulfidiphilus HL-EbGr7] Length=426 Score = 35.0 bits (79), Expect = 5.8, Method: Composition-based stats. Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (3%) Query 31 VVAHPMSYYLN--GGVDLQGISTRKPLPAAFDDAESIASGDVNVFTDPTVGKLDLMDMAS 88 V HP+ + LN G V + TR LP AE+ A G + T+ T ++ L +++ Sbjct 177 VYLHPIDWSLNAKGCVHEGPVGTRLGLPGIPAAAETAALGTILALTEQTGARVHLCRLST 236 Query 89 TMASESEARALKDG 102 A++ ARA DG Sbjct 237 ARAAQMLARARHDG 250 >gi|502275071|ref|WP_012749042.1| glycine betain transporter substrate-binding protein [Geobacillus sp. WCH70] gi|239825867|ref|YP_002948491.1| glycine betain transporter substrate-binding protein [Geobacillus sp. WCH70] gi|239806160|gb|ACS23225.1| Substrate-binding region of ABC-type glycine betaine transport system [Geobacillus sp. WCH70] Length=300 Score = 35.0 bits (79), Expect = 6.4, Method: Compositional matrix adjust. Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Query 26 FVDKVVVAHPMSYYLNGGVDLQGISTRKPLPAAFDDAESIASGDVNVFTDPT-VGKLDLM 84 F ++V++AH ++ YL DL + + L AF +++ GDV+++ + T G L+++ Sbjct 38 FTEQVILAHLLAEYLKANTDLD-VEMKDSLGGAFVLQQAMEKGDVDLYVEYTGTGHLNIL 96 Lambda K H a alpha 0.312 0.129 0.365 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 441262009536