bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-30_CDS_annotation_glimmer3.pl_2_2 Length=98 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_B_021_Microviridae_AG0369_hypothetical.... 20.8 2.9 Gokush_Human_gut_33_023_Microviridae_AG0365_putative.VP3 20.8 3.4 Gokush_Bourget_309_Microviridae_AG0288_putative.VP1 20.8 4.0 Gokush_68_Microbialite_003_Microviridae_AG0157_putative.VP4 20.4 4.5 > Alpavirinae_Human_feces_B_021_Microviridae_AG0369_hypothetical.protein Length=93 Score = 20.8 bits (42), Expect = 2.9, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 17/37 (46%), Gaps = 1/37 (3%) Query 11 PAYVSRGQRIMSVLDGSGSVDV-LPGRPDVVVEPSDF 46 P Y R R LD +D+ R ++ V+P DF Sbjct 43 PEYNIRTDRWDIALDAMNKIDMSRKARKEIDVKPEDF 79 > Gokush_Human_gut_33_023_Microviridae_AG0365_putative.VP3 Length=153 Score = 20.8 bits (42), Expect = 3.4, Method: Compositional matrix adjust. Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%) Query 26 GSGSVDVLPGRPDVVVEPS 44 GSG ++ PGR D +V PS Sbjct 131 GSGIHNLDPGRSDDLVPPS 149 > Gokush_Bourget_309_Microviridae_AG0288_putative.VP1 Length=536 Score = 20.8 bits (42), Expect = 4.0, Method: Composition-based stats. Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%) Query 22 SVLDGSGSVDVLPGRP 37 ++L SG+ V PG P Sbjct 248 AILSASGTTQVAPGTP 263 > Gokush_68_Microbialite_003_Microviridae_AG0157_putative.VP4 Length=337 Score = 20.4 bits (41), Expect = 4.5, Method: Composition-based stats. Identities = 16/56 (29%), Positives = 24/56 (43%), Gaps = 5/56 (9%) Query 36 RPDVVVEPSDFDKGEKFNPEIEFDPNSFSRMDKFDGLEVGQELIDSEIARSKAASK 91 RP + D GEK ++ +++ K LE G IDS ++ ASK Sbjct 155 RPKDSIYKYSTDAGEKV-----YESEELAKIWKKGNLEYGSVTIDSAGYVARYASK 205 Lambda K H a alpha 0.311 0.132 0.369 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 4840122