bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_5 Length=176 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_gut_33_017_Microviridae_AG0155_hypothetical.p... 63.5 8e-15 Alpavirinae_Human_feces_D_031_Microviridae_AG0422_hypothetical.... 43.5 9e-08 Alpavirinae_Human_gut_22_017_Microviridae_AG0398_hypothetical.p... 39.3 1e-06 Alpavirinae_Human_feces_C_043_Microviridae_AG0323_hypothetical.... 36.2 1e-05 Alpavirinae_Human_feces_A_021_Microviridae_AG078_hypothetical.p... 29.6 0.003 Alpavirinae_Human_feces_A_034_Microviridae_AG0103_hypothetical.... 28.1 0.010 Alpavirinae_Human_gut_33_005_Microviridae_AG0181_hypothetical.p... 25.4 0.24 > Alpavirinae_Human_gut_33_017_Microviridae_AG0155_hypothetical.protein Length=171 Score = 63.5 bits (153), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 3/118 (3%) Query 26 GFNPAVREKEIAV--EIDPVSKFCIETIGEGPDKYYRYRSDISMLLHAKDTANKIGIEGL 83 G +P V AV D + +E + RY SDI ++LH KD A++ G++ Sbjct 27 GLSPNVEPDAFAVAPNFDSTEQLRVEIDDTDASRPVRYTSDIRLILHNKDLASRAGVDVA 86 Query 84 RYLSESRRTKTSAIqsqldqmddqllldTVKSRHLQSPSEILAWSESLIQVAHELETR 141 +S+++ S IQ +D M D+ LL TV+SR++QSPSEILAWS+ L A LE++ Sbjct 87 SKFGQSKQSP-SQIQQIMDTMSDEDLLATVRSRYIQSPSEILAWSKELSAYAENLESQ 143 > Alpavirinae_Human_feces_D_031_Microviridae_AG0422_hypothetical.protein Length=150 Score = 43.5 bits (101), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 28/89 (31%), Positives = 45/89 (51%), Gaps = 3/89 (3%) Query 56 DKYYRYRSDISMLLHAKDTANKIGIEGLRYLSESRRTKTSAIqsqldqmddqllldTVKS 115 D RY SD+++L++A+ N+IG E L + K S ++ +KS Sbjct 43 DGVIRYVSDVNLLMNAERLRNQIGEESYLNLIRGIQPKKSPYDNKYTDEQLFT---AIKS 99 Query 116 RHLQSPSEILAWSESLIQVAHELETRVGA 144 R +Q+PSE+LAW ESL + + + A Sbjct 100 RFIQTPSEVLAWIESLGSAGDSIRSELDA 128 > Alpavirinae_Human_gut_22_017_Microviridae_AG0398_hypothetical.protein Length=69 Score = 39.3 bits (90), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%) Query 112 TVKSRHLQSPSEILAWSESLIQVAHELETR 141 TV+SRH+Q+PSEI+AWS+ L A LE++ Sbjct 12 TVRSRHIQAPSEIIAWSKELSAYAEHLESQ 41 > Alpavirinae_Human_feces_C_043_Microviridae_AG0323_hypothetical.protein Length=59 Score = 36.2 bits (82), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%) Query 112 TVKSRHLQSPSEILAWSESLIQVA 135 T+KSR+LQSPSE+ AW E+L+ A Sbjct 3 TIKSRYLQSPSEVRAWLETLVDKA 26 > Alpavirinae_Human_feces_A_021_Microviridae_AG078_hypothetical.protein Length=63 Score = 29.6 bits (65), Expect = 0.003, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 113 VKSRHLQSPSEILAWSESLIQVAHELETRVGAEIRKKYDEEI 154 +K R++QS +E+ AWSE L A E++T I EEI Sbjct 4 IKPRNVQSHAELKAWSEFLTDKAKEIQTEYETYIENIRAEEI 45 > Alpavirinae_Human_feces_A_034_Microviridae_AG0103_hypothetical.protein Length=62 Score = 28.1 bits (61), Expect = 0.010, Method: Compositional matrix adjust. Identities = 14/32 (44%), Positives = 18/32 (56%), Gaps = 0/32 (0%) Query 113 VKSRHLQSPSEILAWSESLIQVAHELETRVGA 144 K R++QS +E+ AW E LI LE V A Sbjct 4 CKDRNIQSYTEMQAWLEHLISEGQSLEGDVAA 35 > Alpavirinae_Human_gut_33_005_Microviridae_AG0181_hypothetical.protein Length=205 Score = 25.4 bits (54), Expect = 0.24, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 114 KSRHLQSPSEILAWSESLIQVAHELETRVGA 144 K R++QS +E+ +W + L+ LE+ + A Sbjct 150 KDRNIQSATEMASWLDHLLSEGQSLESDLQA 180 Lambda K H a alpha 0.314 0.132 0.369 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 12567408