bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-14_CDS_annotation_glimmer3.pl_2_1 Length=83 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_C_043_Microviridae_AG0319_hypothetical.... 23.9 0.12 Gokush_gi|19424724|ref|NP_598340.1|_hypothetical_protein_Sp-4p6... 20.0 4.7 Alpavirinae_Human_feces_A_021_Microviridae_AG076_hypothetical.p... 18.9 6.1 Alpavirinae_Human_gut_30_017_Microviridae_AG0204_hypothetical.p... 19.2 9.2 > Alpavirinae_Human_feces_C_043_Microviridae_AG0319_hypothetical.protein Length=75 Score = 23.9 bits (50), Expect = 0.12, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (7%) Query 26 YIVNSSDLQCFLQHHSSKFLSTPPPVIFQSVLVYDPIVFQSQLDSFRKSISKSNSLNN 83 Y+V D+ +L++ S T V+ ++VLV++P F + L+S R N +NN Sbjct 22 YLVEDKDIPAYLEYERSLGNGTVQ-VLCKNVLVFNPEDFFAALESSRYP---KNPINN 75 > Gokush_gi|19424724|ref|NP_598340.1|_hypothetical_protein_Sp-4p6_[Spiroplasma_phage_4] Length=149 Score = 20.0 bits (40), Expect = 4.7, Method: Compositional matrix adjust. Identities = 6/22 (27%), Positives = 10/22 (45%), Gaps = 0/22 (0%) Query 30 SSDLQCFLQHHSSKFLSTPPPV 51 +DL+ L + +L PP Sbjct 55 GTDLRSMLDKYGDDYLELLPPA 76 > Alpavirinae_Human_feces_A_021_Microviridae_AG076_hypothetical.protein Length=52 Score = 18.9 bits (37), Expect = 6.1, Method: Compositional matrix adjust. Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query 21 KEKKFYIVNSSDLQCFLQHHSSKFLSTPPPVIFQSVLVYD 60 K+++ VNSSD+ FL + L+ ++F YD Sbjct 13 KDQRAVFVNSSDVSDFLSDN----LTPDVVIVFSYCTGYD 48 > Alpavirinae_Human_gut_30_017_Microviridae_AG0204_hypothetical.protein.BACPLE Length=422 Score = 19.2 bits (38), Expect = 9.2, Method: Composition-based stats. Identities = 7/10 (70%), Positives = 8/10 (80%), Gaps = 0/10 (0%) Query 42 SKFLSTPPPV 51 +K LST PPV Sbjct 380 AKVLSTAPPV 389 Lambda K H a alpha 0.320 0.135 0.378 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3643771