bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_1 Length=49 Score E Sequences producing significant alignments: (Bits) Value Gokush_gi|12085137|ref|NP_073539.1|_hypothetical_protein_phiMH2... 22.3 0.14 Alpavirinae_Human_feces_B_021_Microviridae_AG0372_putative.VP4 20.0 1.3 Alpavirinae_Human_feces_B_020_Microviridae_AG0351_putative.VP1 20.0 1.6 Gokush_Human_gut_33_023_Microviridae_AG0366_putative.VP1 20.0 1.7 Gokush_Human_feces_B_029_Microviridae_AG0417_putative.VP1 19.6 2.0 Alpavirinae_Human_feces_B_020_Microviridae_AG0349_putative.VP4 19.2 2.5 Alpavirinae_Human_feces_A_047_Microviridae_AG0312_putative.VP4 19.2 2.9 Alpavirinae_Human_feces_C_029_Microviridae_AG0108_putative.VP4 19.2 3.1 Alpavirinae_Human_feces_A_048_Microviridae_AG086_putative.VP4 19.2 3.3 Gokush_Bourget_224_Microviridae_AG0245_putative.VP1 18.9 4.8 > Gokush_gi|12085137|ref|NP_073539.1|_hypothetical_protein_phiMH2Kp03_[Bdellovibrio_phage_phiMH2K] Length=64 Score = 22.3 bits (46), Expect = 0.14, Method: Compositional matrix adjust. Identities = 6/42 (14%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 8 ELGEKKTKEVEIYVIEGTFAEAYKAAKLFMEKNYYIKSIKEA 49 +LG+ + + + G F + + ++ K+ +++S++ + Sbjct 3 QLGKIQRSTRQPIGLNGLFDPNNHSTRWWLRKHVHLRSLRNS 44 > Alpavirinae_Human_feces_B_021_Microviridae_AG0372_putative.VP4 Length=332 Score = 20.0 bits (40), Expect = 1.3, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 1 MRTKYIIELGEKKTKEVEIYVI 22 +R +I ELG +KT+ + ++ I Sbjct 113 IRHWFITELGHEKTERLHLHGI 134 > Alpavirinae_Human_feces_B_020_Microviridae_AG0351_putative.VP1 Length=651 Score = 20.0 bits (40), Expect = 1.6, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 0/21 (0%) Query 24 GTFAEAYKAAKLFMEKNYYIK 44 G FA A + + +NY IK Sbjct 574 GNFAAGMSEAFMVLNRNYEIK 594 > Gokush_Human_gut_33_023_Microviridae_AG0366_putative.VP1 Length=533 Score = 20.0 bits (40), Expect = 1.7, Method: Composition-based stats. Identities = 14/43 (33%), Positives = 20/43 (47%), Gaps = 3/43 (7%) Query 6 IIELGEKKTKEVEIYVIEGTFA--EAYKAAKLFMEKNYYIKSI 46 + LGE+ EIY +GT A E + + + E YY I Sbjct 416 LAHLGEQTILNKEIYA-QGTAADDEVFGYQERYAEYRYYPSQI 457 > Gokush_Human_feces_B_029_Microviridae_AG0417_putative.VP1 Length=530 Score = 19.6 bits (39), Expect = 2.0, Method: Composition-based stats. Identities = 10/24 (42%), Positives = 15/24 (63%), Gaps = 3/24 (13%) Query 25 TFAEAYKAAKLFMEKNYYIKSIKE 48 T A+ KAAK+F +YY ++ E Sbjct 189 TLAKPLKAAKVF---DYYTGALPE 209 > Alpavirinae_Human_feces_B_020_Microviridae_AG0349_putative.VP4 Length=332 Score = 19.2 bits (38), Expect = 2.5, Method: Compositional matrix adjust. Identities = 7/18 (39%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 5 YIIELGEKKTKEVEIYVI 22 +I ELG +KT+ + ++ I Sbjct 117 FITELGHEKTERLHLHGI 134 > Alpavirinae_Human_feces_A_047_Microviridae_AG0312_putative.VP4 Length=332 Score = 19.2 bits (38), Expect = 2.9, Method: Compositional matrix adjust. Identities = 7/18 (39%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 5 YIIELGEKKTKEVEIYVI 22 +I ELG +KT+ + ++ I Sbjct 117 FITELGHEKTERLHLHGI 134 > Alpavirinae_Human_feces_C_029_Microviridae_AG0108_putative.VP4 Length=291 Score = 19.2 bits (38), Expect = 3.1, Method: Compositional matrix adjust. Identities = 7/18 (39%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 5 YIIELGEKKTKEVEIYVI 22 +I ELG +KT+ + ++ I Sbjct 76 FITELGHEKTERLHLHGI 93 > Alpavirinae_Human_feces_A_048_Microviridae_AG086_putative.VP4 Length=332 Score = 19.2 bits (38), Expect = 3.3, Method: Compositional matrix adjust. Identities = 7/18 (39%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 5 YIIELGEKKTKEVEIYVI 22 +I ELG +KT+ + ++ I Sbjct 117 FITELGHEKTERLHLHGI 134 > Gokush_Bourget_224_Microviridae_AG0245_putative.VP1 Length=536 Score = 18.9 bits (37), Expect = 4.8, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 10/18 (56%), Gaps = 0/18 (0%) Query 9 LGEKKTKEVEIYVIEGTF 26 LGE+ EIYV G+ Sbjct 419 LGEQSILNKEIYVTGGSL 436 Lambda K H a alpha 0.315 0.132 0.344 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3639357