bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-7_CDS_annotation_glimmer3.pl_2_7 Length=106 Score E Sequences producing significant alignments: (Bits) Value mar:MAE_45000 hypothetical protein 36.2 0.11 mno:Mnod_0081 hypothetical protein 35.0 1.4 gba:J421_1018 Aldose 1-epimerase 34.3 3.1 bse:Bsel_1439 type II secretion system protein E 33.1 7.8 > mar:MAE_45000 hypothetical protein Length=55 Score = 36.2 bits (82), Expect = 0.11, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Query 16 SVECFEGEQIEEKVRRIVNNNEPITDGAPIIFTEKKDGVRPEYNVRTDRWDIALD 70 S+ GE + +K +R +NN IT G IIF EK PE++ R+ +W + LD Sbjct 2 SIGYISGEALMQKAKRRINNQFLIT-GFSIIFREKV----PEFSPRSLQWPVLLD 51 > mno:Mnod_0081 hypothetical protein Length=198 Score = 35.0 bits (79), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/65 (28%), Positives = 29/65 (45%), Gaps = 4/65 (6%) Query 35 NNEPITDGAPIIFTEKKDGVRPEYNVRTDRWDIALDAMNKIDMARKAHK----ENEVKPE 90 N E I ++ +D R + + RW LD +NK+ AR H+ ++EV E Sbjct 102 NAEAIARCGTVLTQAVQDAFRNSFELGQKRWQSNLDGLNKLTRARSVHELAMLQSEVARE 161 Query 91 DFGNV 95 N+ Sbjct 162 SLQNL 166 > gba:J421_1018 Aldose 1-epimerase Length=271 Score = 34.3 bits (77), Expect = 3.1, Method: Compositional matrix adjust. Identities = 19/80 (24%), Positives = 36/80 (45%), Gaps = 3/80 (4%) Query 3 KKTIIPGYTGRMKSVECFEGEQIEEKVRRIVNNNEPITDGAPIIFTEKKD-GVRPEYN-V 60 + ++P Y + + +GEQ+ R I G P++F + D G P++ Sbjct 16 RAAVLP-YGAHVTAWSTADGEQLYLSPRTAYEEGSAIRGGVPVVFPQFSDRGPLPKHGFA 74 Query 61 RTDRWDIALDAMNKIDMARK 80 RT WD+ A + + +A + Sbjct 75 RTRAWDVLAHAADAVTLALR 94 > bse:Bsel_1439 type II secretion system protein E Length=555 Score = 33.1 bits (74), Expect = 7.8, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 3/33 (9%) Query 9 GYTGRMKSVECFEGEQIEEKVRRIVNNNEPITD 41 GY GRM E E I++K+RR+V NN+P+ D Sbjct 488 GYKGRMAIHEVLE---IDDKIRRMVMNNQPMED 517 Lambda K H a alpha 0.312 0.133 0.388 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125672059028