bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-5_CDS_annotation_glimmer3.pl_2_1 Length=65 Score E Sequences producing significant alignments: (Bits) Value cqu:CpipJ_CPIJ009464 carboxypeptidase D 33.9 2.3 sbi:SORBI_08g016930 SORBIDRAFT_08g016930, Sb08g016930; hypothe... 32.7 5.2 sci:B446_23480 hypothetical protein 30.4 5.5 mdm:103403291 SNF1-related protein kinase regulatory subunit g... 31.6 8.6 > cqu:CpipJ_CPIJ009464 carboxypeptidase D Length=1032 Score = 33.9 bits (76), Expect = 2.3, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 3/54 (6%) Query 8 KPQLAQSFLVIDPAQVTDVFAVTKADDGTELADKIYGQIWFDCTAKLPISRVAI 61 KP+ +SF V++P++ F D G EL KI+G I + LP S+V I Sbjct 801 KPEKHESFAVLEPSEHMKQFPT---DGGVELKGKIFGYILDEFNHPLPNSKVFI 851 > sbi:SORBI_08g016930 SORBIDRAFT_08g016930, Sb08g016930; hypothetical protein Length=978 Score = 32.7 bits (73), Expect = 5.2, Method: Composition-based stats. Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 2/28 (7%) Query 36 TELADKIYGQI--WFDCTAKLPISRVAI 61 T LA+++YG+I FDCTA +P+SR I Sbjct 217 TTLANQVYGKIKSRFDCTAFVPVSRSPI 244 > sci:B446_23480 hypothetical protein Length=50 Score = 30.4 bits (67), Expect = 5.5, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 22/46 (48%), Gaps = 0/46 (0%) Query 1 MHRVFNQKPQLAQSFLVIDPAQVTDVFAVTKADDGTELADKIYGQI 46 M R N K Q A +L I V V A+T D G + DKI +I Sbjct 1 MQRRVNDKGQTAVEYLGIIAVVVAIVLAITGTDIGQTILDKIQAKI 46 > mdm:103403291 SNF1-related protein kinase regulatory subunit gamma-1-like Length=186 Score = 31.6 bits (70), Expect = 8.6, Method: Compositional matrix adjust. Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query 17 VIDPAQVTDVFAVTKADDGTELADKIYGQIWFDCTAKLPISRVAIP 62 VI+P Q T +T++ L ++ G+ WFDC A PIS +P Sbjct 42 VIEPGQPTLKNYITQSGLVQGL-ERCRGRDWFDCIAAKPISNFGLP 86 Lambda K H a alpha 0.325 0.138 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128662101624