bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-40_CDS_annotation_glimmer3.pl_2_2 Length=278 Score E Sequences producing significant alignments: (Bits) Value fve:101297601 minor spike protein H-like 58.9 3e-08 bde:BDP_1589 chromosome segregation ATPase 36.2 7.4 > fve:101297601 minor spike protein H-like Length=139 Score = 58.9 bits (141), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 43/120 (36%), Positives = 70/120 (58%), Gaps = 20/120 (17%) Query 62 EAAKSRSWQEYMSNTAHQREIRDLKAAGLNPVLSAMGGNGAAVTSGATASGVTSA----- 116 EA ++R +QE +SN+A+QR++ DL +AGLNP+L+ + G GA+ SG+T VTSA Sbjct 25 EAQRNREFQERLSNSAYQRQVADLSSAGLNPMLAYIKGGGASTPSGSTGQ-VTSAQYTSP 83 Query 117 --GAKGEVDTSANAALVQMLGSVLSAQTQLQTANVNARTQEAVADKYTAMEEIVANISRD 174 GA TSA AA + + A +T+N+N ++DK +++ ++N+ D Sbjct 84 IQGAASYRLTSAQAAKTEAEKPKIEA----ETSNIN-----KISDK---IDQEISNLKTD 131 > bde:BDP_1589 chromosome segregation ATPase Length=359 Score = 36.2 bits (82), Expect = 7.4, Method: Compositional matrix adjust. Identities = 29/84 (35%), Positives = 39/84 (46%), Gaps = 5/84 (6%) Query 158 ADKYTAMEEIVANISRDATLGSAGIHAGATRYAADT-----SAAASRYFADKNYEGTKYS 212 AD+Y A+ + T A +A TR ADT A +Y A+K EG Y Sbjct 167 ADEYNKNTHANADSYSEDTRSDADAYAAKTRQDADTYMQDRHNEADQYMAEKTEEGNAYL 226 Query 213 SDKHYQGTMYSANKSYEGTKYSSD 236 + K +G Y A K+ EG +Y SD Sbjct 227 NRKKNEGDAYVAQKTQEGDQYLSD 250 Lambda K H a alpha 0.308 0.120 0.325 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 441950333020