bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-3_CDS_annotation_glimmer3.pl_2_3 Length=68 Score E Sequences producing significant alignments: (Bits) Value fli:Fleli_3723 hypothetical protein 32.3 4.7 smm:Smp_043150 SmIrV1 protein 32.7 5.7 btm:MC28_G329 hypothetical protein 31.2 9.2 > fli:Fleli_3723 hypothetical protein Length=194 Score = 32.3 bits (72), Expect = 4.7, Method: Compositional matrix adjust. Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 2/46 (4%) Query 18 FIIGVITTLF-VQSCTISMSVSKNNQNSTQKTEQTST-SSIDSTKI 61 F++ V TT+ VQ+ M+ +NNQNSTQ T+ TST +SID+ + Sbjct 11 FVLFVYTTVTSVQARVCQMNFDENNQNSTQLTQNTSTIASIDTVAL 56 > smm:Smp_043150 SmIrV1 protein Length=582 Score = 32.7 bits (73), Expect = 5.7, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 0/50 (0%) Query 18 FIIGVITTLFVQSCTISMSVSKNNQNSTQKTEQTSTSSIDSTKININPKN 67 F++G++ TL + C I M S + Q+ ++T TS+ D + +++ +N Sbjct 467 FVVGLVCTLPIILCCIYMCRSPSKQHDIGMRKKTDTSTPDDSHLHVGERN 516 > btm:MC28_G329 hypothetical protein Length=174 Score = 31.2 bits (69), Expect = 9.2, Method: Compositional matrix adjust. Identities = 20/56 (36%), Positives = 34/56 (61%), Gaps = 6/56 (11%) Query 11 IVKLISTFIIGVITTLFVQSCTISMSVSKNNQNSTQKTEQTSTSSIDSTKININPK 66 I+ +IS FI+GV++TL Q+ T NN+ ++ K+E S+ S ++T+ N K Sbjct 8 IITIISVFILGVVSTLVYQAST------GNNKANSIKSENVSSVSKEATENEKNKK 57 Lambda K H a alpha 0.314 0.124 0.334 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127465902564