bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-34_CDS_annotation_glimmer3.pl_2_3 Length=90 Score E Sequences producing significant alignments: (Bits) Value mrr:Moror_481 hypothetical protein 35.0 1.3 pfj:MYCFIDRAFT_46458 hypothetical protein 34.3 2.2 osp:Odosp_2659 hypothetical protein 33.1 5.8 > mrr:Moror_481 hypothetical protein Length=426 Score = 35.0 bits (79), Expect = 1.3, Method: Composition-based stats. Identities = 25/72 (35%), Positives = 31/72 (43%), Gaps = 5/72 (7%) Query 9 WAYGQDVVKVTCIKQGEDDKFVLTVGQYSVTP----IIFDTQEQAETFLETKFKLTNFDL 64 W GQ V V +GED K ++ YS P +FD A LE F L N D Sbjct 310 WCEGQVRVHVDWAAKGEDGKPIVQSAAYSTVPNEAFKVFDLSRPAH-ILEIYFLLRNIDQ 368 Query 65 AVIGAMCQRLNE 76 GA +R+ E Sbjct 369 WTTGAFKERVTE 380 > pfj:MYCFIDRAFT_46458 hypothetical protein Length=437 Score = 34.3 bits (77), Expect = 2.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 0/34 (0%) Query 27 DKFVLTVGQYSVTPIIFDTQEQAETFLETKFKLT 60 DK VLTVG YS T + F +Q QA ++ T +LT Sbjct 213 DKIVLTVGAYSDTLLDFKSQLQATAYVVTHVRLT 246 > osp:Odosp_2659 hypothetical protein Length=531 Score = 33.1 bits (74), Expect = 5.8, Method: Compositional matrix adjust. Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 14/62 (23%) Query 24 GEDDKFVLTVGQYSVTPIIFDTQEQAETFLETKFKLTNFDLAVIGAMCQRLNELNEQNKL 83 G D FV+ GQY+VT I +D Q AE LA+ G + R + + NK+ Sbjct 219 GNGDMFVIDPGQYNVTTIGYDPQIGAEL------------LAITGKIYPR--SMQQDNKV 264 Query 84 YS 85 YS Sbjct 265 YS 266 Lambda K H a alpha 0.315 0.131 0.371 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128026330890