bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-17_CDS_annotation_glimmer3.pl_2_4 Length=635 Score E Sequences producing significant alignments: (Bits) Value aly:ARALYDRAFT_480073 hypothetical protein 42.7 0.30 tcc:TCM_034194 Transcriptional factor B3 family protein / auxi... 39.7 2.6 > aly:ARALYDRAFT_480073 hypothetical protein Length=850 Score = 42.7 bits (99), Expect = 0.30, Method: Compositional matrix adjust. Identities = 32/98 (33%), Positives = 53/98 (54%), Gaps = 7/98 (7%) Query 290 IPFPLENLDLMRDNILKD---TGANS-EYQIRSTTISPYGDLAKRSASGKLSTTSPMFGL 345 IPF NL ++ +L+D TG+ S + +R T Y D++ SG ++ S +F L Sbjct 139 IPFSFSNLSMLSALVLRDNELTGSLSLVWSLRKLT---YLDVSHNHFSGTMNPNSSLFEL 195 Query 346 ALKTYQSDIFNNWINTEWLDGEGGINEITAIDVSSGSL 383 TY + FNN+ ++ G +N++ ++DVSS SL Sbjct 196 HHLTYLNLGFNNFTSSSLPYELGNLNKLESLDVSSSSL 233 > tcc:TCM_034194 Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related Length=951 Score = 39.7 bits (91), Expect = 2.6, Method: Compositional matrix adjust. Identities = 25/90 (28%), Positives = 45/90 (50%), Gaps = 6/90 (7%) Query 213 PNNINR---EVNYNDNILIT---YTTNFKIESTTVKIKLQEKEVTKKLSDVINISSKNEG 266 P+ IN ++N N N+ + + + S+ K+KL+ + T +LS + + S NE Sbjct 508 PDPINSNLPKINANGNLHPPANKFESQTQARSSNEKLKLESEHSTDQLSQLTSTSECNEE 567 Query 267 VVKGTWNMPTAVWINISYKEINLIPFPLEN 296 + P+ + +S+ N IPFPL+N Sbjct 568 KLAANAASPSTILNQLSFPNQNQIPFPLQN 597 Lambda K H a alpha 0.314 0.132 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1487960678397