bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-16_CDS_annotation_glimmer3.pl_2_9 Length=59 Score E Sequences producing significant alignments: (Bits) Value cput:CONPUDRAFT_70880 phosphoglycerate mutase-like protein 33.1 3.4 lch:Lcho_3395 gltD; glutamate synthase subunit beta 32.7 4.4 fco:FCOL_02460 tonB-dependent receptor 32.0 8.9 gtr:GLOTRDRAFT_79745 phosphoglycerate mutase-like protein 31.6 9.9 > cput:CONPUDRAFT_70880 phosphoglycerate mutase-like protein Length=442 Score = 33.1 bits (74), Expect = 3.4, Method: Composition-based stats. Identities = 15/49 (31%), Positives = 25/49 (51%), Gaps = 0/49 (0%) Query 5 KQLLENYVVIEIRFKEYKRILIILKGKDSKKQKSKWIDKNYFKRNYPNT 53 KQL ++ V + + I+ G+D + ++W K YF R YPN+ Sbjct 124 KQLFDHGVDFLLDYPHLHTDTIVAGGQDRVIESAEWFAKGYFGRYYPNS 172 > lch:Lcho_3395 gltD; glutamate synthase subunit beta Length=491 Score = 32.7 bits (73), Expect = 4.4, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 0/38 (0%) Query 5 KQLLENYVVIEIRFKEYKRILIILKGKDSKKQKSKWID 42 ++L E Y +E R K YK +I LK DSK Q ++ +D Sbjct 11 ERLEEGYEPVEKRVKNYKEFVIGLKADDSKVQAARCMD 48 > fco:FCOL_02460 tonB-dependent receptor Length=873 Score = 32.0 bits (71), Expect = 8.9, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 26/51 (51%), Gaps = 1/51 (2%) Query 8 LENYVV-IEIRFKEYKRILIILKGKDSKKQKSKWIDKNYFKRNYPNTSKFF 57 LEN +V +E +R+L +L+ D K SKW D YF Y T FF Sbjct 354 LENNIVKLESGLFNTQRVLTMLQILDQKHLVSKWNDNAYFASEYNYTDGFF 404 > gtr:GLOTRDRAFT_79745 phosphoglycerate mutase-like protein Length=433 Score = 31.6 bits (70), Expect = 9.9, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 26/49 (53%), Gaps = 0/49 (0%) Query 6 QLLENYVVIEIRFKEYKRILIILKGKDSKKQKSKWIDKNYFKRNYPNTS 54 +L ++ V +++ ++ I+ G+D + ++W Y+ R +PN S Sbjct 123 ELFKHGVNFRLKYPQFNATSILAGGQDRVIESAQWFANGYYGRTWPNIS 171 Lambda K H a alpha 0.321 0.138 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125989489341