bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-8_CDS_annotation_glimmer3.pl_2_9 Length=239 Score E Sequences producing significant alignments: (Bits) Value 272563.CD2076 36.6 3.9 > 272563.CD2076 Length=363 Score = 36.6 bits (83), Expect = 3.9, Method: Compositional matrix adjust. Identities = 46/178 (26%), Positives = 77/178 (43%), Gaps = 19/178 (11%) Query 67 QEIDVA---MSEARERISTMKAQQSQIDENMVQLKFDRYLRSKEFELLCKRTYQDMKESN 123 QEI++ MSE R+ I+TMK S++ + M +K D +E +L +DM E Sbjct 130 QEINIMKEDMSEVRQEINTMKEDMSEVRQEMTVMKEDMSEVKQEINVL----KEDMSEVR 185 Query 124 SRINLNAAEVQDMMATQLARVMNLNASTYMQKKQGILASEQTMTELYKQTGI---DISNQ 180 IN+ ++ + Q VM + S KQ I ++ M+E+ ++ + D+S Sbjct 186 QEINIMKEDMSE--VRQEMTVMKEDTSEV---KQEINVMKKDMSEVRQEITVMKEDVSEV 240 Query 181 HAKFNFDQAKNWDSTERFTNVATTWINSVSFAVGQFAGATTSLQKGGFLGKSMSPIGF 238 ++ NF Q K + E + + VS A + G + KSM I Sbjct 241 KSEVNFMQNKINNINEDMNGIK----DEVSIANEKLYGIEIKIDSLECEDKSMKEIQI 294 Lambda K H a alpha 0.312 0.123 0.328 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 322857676960