bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-40_CDS_annotation_glimmer3.pl_2_2 Length=278 Score E Sequences producing significant alignments: (Bits) Value 553217.ENHAE0001_2219 48.1 0.001 > 553217.ENHAE0001_2219 Length=488 Score = 48.1 bits (113), Expect = 0.001, Method: Compositional matrix adjust. Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%) Query 194 SAAASRYFADKNYEGTKYSSDKHYQGTMYSANKSYEGTKYSSDNSVRNPSSAVGYAREIG 253 S AS Y +D + +GT YSSD +GTMYS++ S EGTKY+++ + + A++ G Sbjct 237 STQASMYASDNSLKGTMYSSDNSLKGTMYSSDNSLEGTKYTANQATYRTEKEIEAAKKQG 296 Query 254 K 254 K Sbjct 297 K 297 Lambda K H a alpha 0.308 0.120 0.325 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 433525604880