bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-38_CDS_annotation_glimmer3.pl_2_3 Length=73 Score E Sequences producing significant alignments: (Bits) Value 12957.ACEP_00002227-PA 32.3 6.7 > 12957.ACEP_00002227-PA Length=748 Score = 32.3 bits (72), Expect = 6.7, Method: Compositional matrix adjust. Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 2/42 (5%) Query 5 RPYKAYLYQSSNMLEDNQFYLVTEI--YLNARSFVEFSHKIS 44 +P+ A Y N LE +Y +T+ Y+NARS VEF +KI+ Sbjct 155 KPFHALKYIVDNYLESYDYYFLTKDVNYINARSLVEFVNKIT 196 Lambda K H a alpha 0.319 0.132 0.366 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 129284145130