bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_1 Length=206 Score E Sequences producing significant alignments: (Bits) Value 7668.SPU_002034tr 35.8 6.4 > 7668.SPU_002034tr Length=561 Score = 35.8 bits (81), Expect = 6.4, Method: Compositional matrix adjust. Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 7/90 (8%) Query 69 EREKMWINNLNRGLIWIYGEKVKADDWKTIDNLRAYWQK--YGCEVMGDNPIAWNAMKER 126 E K +N+L G+ +IY +V +DD+ D R W +GC GD +A N +K R Sbjct 25 ESAKRHLNHL--GITFIY--EVGSDDYILSDRDRLQWLDLLHGCLQEGDRVLAINELK-R 79 Query 127 RKEEKQRRAVALAKKQAEKFSTENLIEELP 156 ++EK+ A + KK K + + ELP Sbjct 80 AEKEKRSLAAEMTKKLETKQHHVDSLTELP 109 Lambda K H a alpha 0.318 0.133 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 228793081400