bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-46_CDS_annotation_glimmer3.pl_2_1 Length=107 Score E Sequences producing significant alignments: (Bits) Value gi|655126327|ref|WP_028573442.1| taurine ABC transporter permease 40.4 0.082 gi|573500917|gb|ETT01370.1| glycosyltransferase, group 1 family ... 39.3 0.21 gi|667765371|ref|WP_031386338.1| taurine ABC transporter permease 36.6 1.5 gi|586668262|ref|XP_006833500.1| hypothetical protein AMTR_s0009... 36.2 2.7 gi|548188961|ref|WP_022409828.1| uncharacterized protein 35.4 3.5 >gi|655126327|ref|WP_028573442.1| taurine ABC transporter permease [Desulfonatronum lacustre] Length=337 Score = 40.4 bits (93), Expect = 0.082, Method: Composition-based stats. Identities = 29/101 (29%), Positives = 45/101 (45%), Gaps = 7/101 (7%) Query 11 INDPNLTYQAEPREVKLRKIINGEANNMEDGVFPTIYTEKKDGVQPEFDIRTDRFEIAID 70 I P L Q E + LR ++ G A +ED Y ++DG+ + D+ T R ++AI+ Sbjct 221 IVSPQLAAQPEAVKGFLRAVVRGWAETLEDPAAAIAYVRERDGL-IDVDLETRRLKLAIE 279 Query 71 AMDKINQSAASQIAKSSGE------TEAVKDFGTETKTDPE 105 + +AA+ + E E V FG T PE Sbjct 280 TSVATDYAAANGMGDVDDERLVKAIAEVVNAFGLSTTPAPE 320 >gi|573500917|gb|ETT01370.1| glycosyltransferase, group 1 family protein [Providencia alcalifaciens PAL-3] gi|577061970|gb|EUC99001.1| glycosyltransferase, group 1 family protein [Providencia alcalifaciens PAL-1] Length=360 Score = 39.3 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 21/91 (23%), Positives = 50/91 (55%), Gaps = 3/91 (3%) Query 10 WINDPNLTYQAEPREVKLRKIINGEANNMEDGVFPTIYTEKKDGVQPEFD--IRTDRFE- 66 +IN+ N+ + E K++KII+ NN+ + P I+ + KD + E++ I T R+E Sbjct 205 YINEFNIFGASLEEEAKIKKIISNIPNNISIKIHPPIFNQDKDNILSEYNIYIMTSRYEG 264 Query 67 IAIDAMDKINQSAASQIAKSSGETEAVKDFG 97 + + ++ ++ +++ + ++ V+ +G Sbjct 265 LPVSVIEALSYGCICLLSEGTNLSKLVEKYG 295 >gi|667765371|ref|WP_031386338.1| taurine ABC transporter permease [Desulfonatronum thiodismutans] Length=333 Score = 36.6 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 28/101 (28%), Positives = 43/101 (43%), Gaps = 7/101 (7%) Query 11 INDPNLTYQAEPREVKLRKIINGEANNMEDGVFPTIYTEKKDGVQPEFDIRTDRFEIAID 70 I P L Q E + LR ++ G A +ED Y ++DG+ + D+ T R ++AI+ Sbjct 217 IVSPQLAAQPEVVKGFLRAVVRGWAETLEDPAAAIAYVRQRDGL-IDVDLETRRLKLAIE 275 Query 71 AMDKINQSAASQIAKSSGE------TEAVKDFGTETKTDPE 105 +AA+ + E E V F T PE Sbjct 276 TSVATEYAAANGMGDVDDERLAKAIAEVVNAFDLSTTPAPE 316 >gi|586668262|ref|XP_006833500.1| hypothetical protein AMTR_s00093p00015400 [Amborella trichopoda] gi|548838227|gb|ERM98778.1| hypothetical protein AMTR_s00093p00015400 [Amborella trichopoda] Length=589 Score = 36.2 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 31/51 (61%), Gaps = 2/51 (4%) Query 57 EFDIRT--DRFEIAIDAMDKINQSAASQIAKSSGETEAVKDFGTETKTDPE 105 EFD + + FE+A +++ + +I + +GETE ++++G +TDPE Sbjct 7 EFDCESVIEAFEVATKDAERVQRETLRRILEENGETEYLQEWGLRGRTDPE 57 >gi|548188961|ref|WP_022409828.1| uncharacterized protein [Ruminococcus sp. CAG:330] gi|524706212|emb|CDE12308.1| uncharacterized protein BN611_00105 [Ruminococcus sp. CAG:330] Length=326 Score = 35.4 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 2/82 (2%) Query 23 REVKLRKIINGEANNMEDGVFPTIYTEKKDGVQPEFDIRTDRFEIAIDAMDKINQSAASQ 82 +EV L+ + E+ + D F ++ EK + + PE I++ +++ I+ D I + A Q Sbjct 145 KEVALKPVKAAESLSFNDYRFENVFAEKFNQLSPEEPIQS-LYDLDINPWD-IEEPACKQ 202 Query 83 IAKSSGETEAVKDFGTETKTDP 104 K+SG + F T++DP Sbjct 203 FIKNSGWGHKIGGFPAFTQSDP 224 Lambda K H a alpha 0.308 0.127 0.348 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 428991919341