bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-21_CDS_annotation_glimmer3.pl_2_7 Length=107 Score E Sequences producing significant alignments: (Bits) Value gi|566217273|gb|ETI82950.1| hypothetical protein Q618_VCMC00001G... 34.7 6.8 gi|497673322|ref|WP_009987506.1| 2-C-methyl-D-erythritol 4-phosp... 34.3 9.3 >gi|566217273|gb|ETI82950.1| hypothetical protein Q618_VCMC00001G0531 [Varibaculum cambriense DORA_20] Length=192 Score = 34.7 bits (78), Expect = 6.8, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 30/57 (53%), Gaps = 3/57 (5%) Query 2 AQAAYYYAAGETQKAE-AKMLEVKKRTEEATAELRELQYWTEIANTIIKLAQVVGNL 57 A A+++ AAG ++ A E+KKR+E A ELR WT + N + A + L Sbjct 114 ADASFFQAAGSVSRSHSASFGELKKRSESAEMELR--ASWTPLENNLAPHAAAISRL 168 >gi|497673322|ref|WP_009987506.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Ruminococcus flavefaciens] Length=228 Score = 34.3 bits (77), Expect = 9.3, Method: Compositional matrix adjust. Identities = 18/57 (32%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Query 47 IIKLAQVVGNLTIGGKTGKLIREYTEKRMSETPPKNSTTVTQH---FDPEMQFKGVD 100 +IK A+V G T+G I+ + +++TPP+N +TQ F + F+G+D Sbjct 118 VIKDAKVFGGATLGVPVKDTIKTVDDGLITDTPPRNKLFITQTPQIFKRSLYFEGID 174 Lambda K H a alpha 0.310 0.124 0.345 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 428991919341