bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-19_CDS_annotation_glimmer3.pl_2_3 Length=73 Score E Sequences producing significant alignments: (Bits) Value gi|671511687|ref|WP_031497761.1| hypothetical protein 35.0 1.5 >gi|671511687|ref|WP_031497761.1| hypothetical protein [Bryobacter aggregatus] Length=148 Score = 35.0 bits (79), Expect = 1.5, Method: Compositional matrix adjust. Identities = 14/43 (33%), Positives = 24/43 (56%), Gaps = 0/43 (0%) Query 8 VRDQTEKDLRLEADNLYRKIETQYKLIKKISDKEEAHKIIDRI 50 VR+Q E + L D LYR +E+ Y+++ ++ D+ D I Sbjct 50 VRNQLESNATLNVDALYRSLESDYRVVTQLLDQAPGGSFEDNI 92 Lambda K H a alpha 0.317 0.133 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 430018305192