bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-17_CDS_annotation_glimmer3.pl_2_6 Length=367 Score E Sequences producing significant alignments: (Bits) Value gi|575094319|emb|CDL65706.1| unnamed protein product 38.5 6.7 >gi|575094319|emb|CDL65706.1| unnamed protein product [uncultured bacterium] Length=396 Score = 38.5 bits (88), Expect = 6.7, Method: Compositional matrix adjust. Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Query 27 ISTASNAVGGAMSAKDAKRQHQYDLEKMAVQHGYNIESQKLGQQFNKEMWDYTNYEN--- 83 I+ A + + G S+ +K+ +Y L+ + + N E +FN+ MW+ N N Sbjct 29 IAGAGSLINGLFSSNGSKQAAKYQLQAVRETNQANREIADQNNKFNERMWNLQNEYNRPD 88 Query 84 -QKKHLEAAGLNP 95 Q+ LEAAGLNP Sbjct 89 MQRARLEAAGLNP 101 Lambda K H a alpha 0.311 0.128 0.351 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 2236817440716