bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-17_CDS_annotation_glimmer3.pl_2_3 Length=76 Score E Sequences producing significant alignments: (Bits) Value gi|598041547|ref|XP_007350146.1| metal-dependent amidase/aminoac... 35.0 3.3 >gi|598041547|ref|XP_007350146.1| metal-dependent amidase/aminoacylase/carboxypeptidase [Auricularia delicata TFB-10046 SS5] gi|393234180|gb|EJD41745.1| metal-dependent amidase/aminoacylase/carboxypeptidase [Auricularia delicata TFB-10046 SS5] Length=424 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 18/53 (34%), Positives = 32/53 (60%), Gaps = 3/53 (6%) Query 1 MNFNEVFKVRTVKKNE---EDTYVITIGNRLASEEEFKTAQKAQMKINKTDWN 50 M + V +++++ E EDT V+T+G+ +A + E A KA+MK+N +N Sbjct 227 MAASAVVRLQSIVSREVAPEDTAVVTVGSLVAGQTENIIADKAEMKVNVRSYN 279 Lambda K H a alpha 0.308 0.123 0.320 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 442533451452