bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-16_CDS_annotation_glimmer3.pl_2_7 Length=70 Score E Sequences producing significant alignments: (Bits) Value gi|665787193|ref|XP_008556236.1| PREDICTED: dynein heavy chain 7... 34.7 4.6 gi|652351884|ref|WP_026748114.1| hypothetical protein 34.3 4.9 gi|443705946|gb|ELU02242.1| hypothetical protein CAPTEDRAFT_227853 34.3 6.8 >gi|665787193|ref|XP_008556236.1| PREDICTED: dynein heavy chain 7, axonemal [Microplitis demolitor] Length=3943 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 15/52 (29%), Positives = 31/52 (60%), Gaps = 0/52 (0%) Query 5 KFSVITTGNNPSFHMSIKELPAECTYKIAVTIAKAIVPKDERIIAVVESWKL 56 K S+ TTG + S + +KEL T+ + + I +++ KD+ + +++ S +L Sbjct 3155 KMSIDTTGQSESLELHLKELTKNLTHSLYINICRSLFEKDKLLFSMLLSIQL 3206 >gi|652351884|ref|WP_026748114.1| hypothetical protein [Leptotrichia trevisanii] Length=293 Score = 34.3 bits (77), Expect = 4.9, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (4%) Query 9 ITTGNNPSFHMSIKELPAECTYKIAVTIAKAIVPKD--ERIIAVVESWKLYPNENEK 63 + G+ PSF + E+P + I VT+AK V KD E+ + + KL NE+E+ Sbjct 126 LDKGDMPSFEKYMDEIPKKYNDTIVVTLAKIFVAKDFEEKQMLTEKVLKLLKNESER 182 >gi|443705946|gb|ELU02242.1| hypothetical protein CAPTEDRAFT_227853 [Capitella teleta] Length=856 Score = 34.3 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (51%), Gaps = 0/51 (0%) Query 11 TGNNPSFHMSIKELPAECTYKIAVTIAKAIVPKDERIIAVVESWKLYPNEN 61 TGN+ FHM + LPAE KI + + + +E ++A+ L P N Sbjct 114 TGNSDIFHMKLGNLPAETEAKITIAYVQELSVDNEGVVALTIPTVLNPRYN 164 Lambda K H a alpha 0.313 0.126 0.355 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 434135247084