bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-6_CDS_annotation_glimmer3.pl_2_3 Length=57 Score E Sequences producing significant alignments: (Bits) Value Gokush_gi|12085137|ref|NP_073539.1|_hypothetical_protein_phiMH2... 22.3 0.22 Alpavirinae_Human_feces_B_021_Microviridae_AG0372_putative.VP4 21.6 0.59 Alpavirinae_Human_feces_B_020_Microviridae_AG0349_putative.VP4 20.0 2.1 Gokush_Human_feces_B_029_Microviridae_AG0417_putative.VP1 20.0 2.2 Alpavirinae_Human_feces_B_020_Microviridae_AG0351_putative.VP1 20.0 2.3 Gokush_Human_gut_33_023_Microviridae_AG0366_putative.VP1 20.0 2.4 Alpavirinae_Human_feces_C_029_Microviridae_AG0108_putative.VP4 19.6 2.5 Alpavirinae_Human_feces_A_047_Microviridae_AG0312_putative.VP4 19.6 2.5 Alpavirinae_Human_feces_A_048_Microviridae_AG086_putative.VP4 19.6 3.1 Gokush_Bourget_224_Microviridae_AG0245_putative.VP1 18.9 6.8 > Gokush_gi|12085137|ref|NP_073539.1|_hypothetical_protein_phiMH2Kp03_[Bdellovibrio_phage_phiMH2K] Length=64 Score = 22.3 bits (46), Expect = 0.22, Method: Compositional matrix adjust. Identities = 6/42 (14%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 16 ELGEKKTKEVEIYVIEGTFAEAYKAAKLFMEKNYYIKSIKEA 57 +LG+ + + + G F + + ++ K+ +++S++ + Sbjct 3 QLGKIQRSTRQPIGLNGLFDPNNHSTRWWLRKHVHLRSLRNS 44 > Alpavirinae_Human_feces_B_021_Microviridae_AG0372_putative.VP4 Length=332 Score = 21.6 bits (44), Expect = 0.59, Method: Compositional matrix adjust. Identities = 9/24 (38%), Positives = 16/24 (67%), Gaps = 0/24 (0%) Query 7 KVMRTKYIIELGEKKTKEVEIYVI 30 K +R +I ELG +KT+ + ++ I Sbjct 111 KSIRHWFITELGHEKTERLHLHGI 134 > Alpavirinae_Human_feces_B_020_Microviridae_AG0349_putative.VP4 Length=332 Score = 20.0 bits (40), Expect = 2.1, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 16/24 (67%), Gaps = 0/24 (0%) Query 7 KVMRTKYIIELGEKKTKEVEIYVI 30 K ++ +I ELG +KT+ + ++ I Sbjct 111 KSIKHWFITELGHEKTERLHLHGI 134 > Gokush_Human_feces_B_029_Microviridae_AG0417_putative.VP1 Length=530 Score = 20.0 bits (40), Expect = 2.2, Method: Composition-based stats. Identities = 10/24 (42%), Positives = 15/24 (63%), Gaps = 3/24 (13%) Query 33 TFAEAYKAAKLFMEKNYYIKSIKE 56 T A+ KAAK+F +YY ++ E Sbjct 189 TLAKPLKAAKVF---DYYTGALPE 209 > Alpavirinae_Human_feces_B_020_Microviridae_AG0351_putative.VP1 Length=651 Score = 20.0 bits (40), Expect = 2.3, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 0/21 (0%) Query 32 GTFAEAYKAAKLFMEKNYYIK 52 G FA A + + +NY IK Sbjct 574 GNFAAGMSEAFMVLNRNYEIK 594 > Gokush_Human_gut_33_023_Microviridae_AG0366_putative.VP1 Length=533 Score = 20.0 bits (40), Expect = 2.4, Method: Composition-based stats. Identities = 14/43 (33%), Positives = 20/43 (47%), Gaps = 3/43 (7%) Query 14 IIELGEKKTKEVEIYVIEGTFA--EAYKAAKLFMEKNYYIKSI 54 + LGE+ EIY +GT A E + + + E YY I Sbjct 416 LAHLGEQTILNKEIYA-QGTAADDEVFGYQERYAEYRYYPSQI 457 > Alpavirinae_Human_feces_C_029_Microviridae_AG0108_putative.VP4 Length=291 Score = 19.6 bits (39), Expect = 2.5, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 16/24 (67%), Gaps = 0/24 (0%) Query 7 KVMRTKYIIELGEKKTKEVEIYVI 30 K ++ +I ELG +KT+ + ++ I Sbjct 70 KSIKHWFITELGHEKTERLHLHGI 93 > Alpavirinae_Human_feces_A_047_Microviridae_AG0312_putative.VP4 Length=332 Score = 19.6 bits (39), Expect = 2.5, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 16/24 (67%), Gaps = 0/24 (0%) Query 7 KVMRTKYIIELGEKKTKEVEIYVI 30 K ++ +I ELG +KT+ + ++ I Sbjct 111 KSIKHWFITELGHEKTERLHLHGI 134 > Alpavirinae_Human_feces_A_048_Microviridae_AG086_putative.VP4 Length=332 Score = 19.6 bits (39), Expect = 3.1, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 16/24 (67%), Gaps = 0/24 (0%) Query 7 KVMRTKYIIELGEKKTKEVEIYVI 30 K ++ +I ELG +KT+ + ++ I Sbjct 111 KSIKHWFITELGHEKTERLHLHGI 134 > Gokush_Bourget_224_Microviridae_AG0245_putative.VP1 Length=536 Score = 18.9 bits (37), Expect = 6.8, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 10/18 (56%), Gaps = 0/18 (0%) Query 17 LGEKKTKEVEIYVIEGTF 34 LGE+ EIYV G+ Sbjct 419 LGEQSILNKEIYVTGGSL 436 Lambda K H a alpha 0.316 0.133 0.340 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3661448