bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-45_CDS_annotation_glimmer3.pl_2_1 Length=45 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_C_043_Microviridae_AG0321_putative.VP4 21.2 0.44 Gokush_Human_gut_33_018_Microviridae_AG0172_putative.VP2 19.6 1.8 Gokush_SectLung2LLL_002_Microviridae_AG0239_putative.VP4 19.2 2.2 Alpavirinae_Human_feces_B_020_Microviridae_AG0356_hypothetical.... 18.5 4.4 Alpavirinae_Human_feces_C_010_Microviridae_AG0201_hypothetical.... 18.1 4.4 Alpavirinae_Human_feces_A_034_Microviridae_AG0102_putative.VP4 18.5 4.5 Alpavirinae_Human_gut_21_005_Microviridae_AG017_hypothetical.pr... 18.1 5.6 Alpavirinae_Human_gut_22_017_Microviridae_AG0396_hypothetical.p... 17.7 7.8 > Alpavirinae_Human_feces_C_043_Microviridae_AG0321_putative.VP4 Length=546 Score = 21.2 bits (43), Expect = 0.44, Method: Compositional matrix adjust. Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%) Query 25 KANMDYTENIKHRAVVD 41 KA+ DY EN K +A +D Sbjct 124 KADKDYIENFKKQANLD 140 > Gokush_Human_gut_33_018_Microviridae_AG0172_putative.VP2 Length=242 Score = 19.6 bits (39), Expect = 1.8, Method: Composition-based stats. Identities = 8/27 (30%), Positives = 15/27 (56%), Gaps = 0/27 (0%) Query 19 FQYQVQKANMDYTENIKHRAVVDSYKN 45 +Q Q+Q A+ Y + +H+ V +N Sbjct 58 YQAQLQNASWKYQMSNRHQLEVGDLRN 84 > Gokush_SectLung2LLL_002_Microviridae_AG0239_putative.VP4 Length=294 Score = 19.2 bits (38), Expect = 2.2, Method: Compositional matrix adjust. Identities = 7/19 (37%), Positives = 11/19 (58%), Gaps = 0/19 (0%) Query 22 QVQKANMDYTENIKHRAVV 40 +++ N D+TEN R V Sbjct 260 KIRMENFDHTENTPERLAV 278 > Alpavirinae_Human_feces_B_020_Microviridae_AG0356_hypothetical.protein Length=55 Score = 18.5 bits (36), Expect = 4.4, Method: Compositional matrix adjust. Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 0/22 (0%) Query 23 VQKANMDYTENIKHRAVVDSYK 44 V KA M E + AVV+S+K Sbjct 16 VAKALMQEVEGEEIVAVVESWK 37 > Alpavirinae_Human_feces_C_010_Microviridae_AG0201_hypothetical.protein Length=54 Score = 18.1 bits (35), Expect = 4.4, Method: Compositional matrix adjust. Identities = 9/21 (43%), Positives = 12/21 (57%), Gaps = 0/21 (0%) Query 10 FNILKTRSIFQYQVQKANMDY 30 FN T F+ Q+Q AN+ Y Sbjct 25 FNRPSTAERFRKQLQDANIGY 45 > Alpavirinae_Human_feces_A_034_Microviridae_AG0102_putative.VP4 Length=539 Score = 18.5 bits (36), Expect = 4.5, Method: Compositional matrix adjust. Identities = 10/33 (30%), Positives = 17/33 (52%), Gaps = 0/33 (0%) Query 7 TYDFNILKTRSIFQYQVQKANMDYTENIKHRAV 39 T+DF+ + S Q +KA++ YT R + Sbjct 113 TFDFDTQLSWSSAQLLQKKAHLHYTSFPDGRCI 145 > Alpavirinae_Human_gut_21_005_Microviridae_AG017_hypothetical.protein Length=54 Score = 18.1 bits (35), Expect = 5.6, Method: Compositional matrix adjust. Identities = 9/21 (43%), Positives = 12/21 (57%), Gaps = 0/21 (0%) Query 10 FNILKTRSIFQYQVQKANMDY 30 FN T F+ Q+Q AN+ Y Sbjct 25 FNRPSTAERFRKQLQDANIGY 45 > Alpavirinae_Human_gut_22_017_Microviridae_AG0396_hypothetical.protein.BACPLE Length=386 Score = 17.7 bits (34), Expect = 7.8, Method: Composition-based stats. Identities = 8/26 (31%), Positives = 13/26 (50%), Gaps = 0/26 (0%) Query 1 MSPFTGTYDFNILKTRSIFQYQVQKA 26 M PF Y +IFQY++ ++ Sbjct 113 MQPFQADYSGIGSSIGNIFQYELMQS 138 Lambda K H a alpha 0.320 0.131 0.375 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3701457