bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-42_CDS_annotation_glimmer3.pl_2_3 Length=64 Score E Sequences producing significant alignments: (Bits) Value Pichovirinae_59_Coral_002_Microviridae_AG0339_putative.VP1 20.4 1.8 Gokush_Human_gut_33_018_Microviridae_AG0169_putative.VP4 19.6 3.9 Alpavirinae_Human_feces_D_031_Microviridae_AG0423_putative.VP4 19.2 5.4 Gokush_Human_gut_37_015_Microviridae_AG031_putative.VP4 18.9 6.7 Gokush_Human_gut_36_019_Microviridae_AG0277_putative.VP4 18.9 6.7 Gokush_Human_gut_35_025_Microviridae_AG0357_putative.VP4 18.9 6.7 Gokush_Human_gut_34_012_Microviridae_AG056_putative.VP4 18.9 6.7 > Pichovirinae_59_Coral_002_Microviridae_AG0339_putative.VP1 Length=522 Score = 20.4 bits (41), Expect = 1.8, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 14/32 (44%), Gaps = 0/32 (0%) Query 18 ASYTWEQKQMMRFAASSRSMPDFDPPTWLDLD 49 A YT++ + S + + D P LD D Sbjct 233 AGYTFDGASALYTGGSGQLIADLPTPVSLDFD 264 > Gokush_Human_gut_33_018_Microviridae_AG0169_putative.VP4 Length=276 Score = 19.6 bits (39), Expect = 3.9, Method: Composition-based stats. Identities = 5/10 (50%), Positives = 8/10 (80%), Gaps = 0/10 (0%) Query 51 LHFWRDHYKL 60 + +WRD YK+ Sbjct 224 MKYWRDFYKI 233 > Alpavirinae_Human_feces_D_031_Microviridae_AG0423_putative.VP4 Length=532 Score = 19.2 bits (38), Expect = 5.4, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 15/29 (52%), Gaps = 0/29 (0%) Query 16 RRASYTWEQKQMMRFAASSRSMPDFDPPT 44 RR S E +++R+A + + P F T Sbjct 325 RRHSDIHELTEILRYARNFKQRPAFQKAT 353 > Gokush_Human_gut_37_015_Microviridae_AG031_putative.VP4 Length=315 Score = 18.9 bits (37), Expect = 6.7, Method: Composition-based stats. Identities = 5/8 (63%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 53 FWRDHYKL 60 +WRD YK+ Sbjct 226 YWRDFYKI 233 > Gokush_Human_gut_36_019_Microviridae_AG0277_putative.VP4 Length=315 Score = 18.9 bits (37), Expect = 6.7, Method: Composition-based stats. Identities = 5/8 (63%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 53 FWRDHYKL 60 +WRD YK+ Sbjct 226 YWRDFYKI 233 > Gokush_Human_gut_35_025_Microviridae_AG0357_putative.VP4 Length=315 Score = 18.9 bits (37), Expect = 6.7, Method: Composition-based stats. Identities = 5/8 (63%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 53 FWRDHYKL 60 +WRD YK+ Sbjct 226 YWRDFYKI 233 > Gokush_Human_gut_34_012_Microviridae_AG056_putative.VP4 Length=315 Score = 18.9 bits (37), Expect = 6.7, Method: Composition-based stats. Identities = 5/8 (63%), Positives = 7/8 (88%), Gaps = 0/8 (0%) Query 53 FWRDHYKL 60 +WRD YK+ Sbjct 226 YWRDFYKI 233 Lambda K H a alpha 0.326 0.134 0.450 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3692164