bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-28_CDS_annotation_glimmer3.pl_2_3 Length=235 Score E Sequences producing significant alignments: (Bits) Value Gokush_Human_gut_21_019_Microviridae_AG0380_putative.VP1 23.9 1.4 Gokush_Human_gut_31_054_Microviridae_AG0236_putative.VP1 23.9 1.4 Gokush_Human_gut_27_015_Microviridae_AG040_putative.VP1 23.9 1.4 Gokush_Bourget_259_Microviridae_AG073_putative.VP1 22.7 3.3 Gokush_Bourget_248_Microviridae_AG0251_putative.VP1 22.7 3.4 Gokush_Bourget_504_Microviridae_AG0256_putative.VP1 22.3 4.5 Gokush_gi|9634949|ref|NP_054647.1|_structural_protein_[Chlamydi... 21.9 6.2 Gokush_gi|47566141|ref|YP_022479.1|_structural_protein_[Chlamyd... 21.9 6.2 Gokush_gi|17402851|ref|NP_510872.1|_hypothetical_protein_PhiCPG... 21.9 6.4 Gokush_gi|77020115|ref|YP_338238.1|_putative_major_coat_protein... 21.9 6.6 > Gokush_Human_gut_21_019_Microviridae_AG0380_putative.VP1 Length=563 Score = 23.9 bits (50), Expect = 1.4, Method: Compositional matrix adjust. Identities = 8/11 (73%), Positives = 10/11 (91%), Gaps = 0/11 (0%) Query 120 PKGKRRDHFTS 130 P+GKR D+FTS Sbjct 191 PRGKRHDYFTS 201 > Gokush_Human_gut_31_054_Microviridae_AG0236_putative.VP1 Length=563 Score = 23.9 bits (50), Expect = 1.4, Method: Compositional matrix adjust. Identities = 8/11 (73%), Positives = 10/11 (91%), Gaps = 0/11 (0%) Query 120 PKGKRRDHFTS 130 P+GKR D+FTS Sbjct 191 PRGKRHDYFTS 201 > Gokush_Human_gut_27_015_Microviridae_AG040_putative.VP1 Length=563 Score = 23.9 bits (50), Expect = 1.4, Method: Compositional matrix adjust. Identities = 8/11 (73%), Positives = 10/11 (91%), Gaps = 0/11 (0%) Query 120 PKGKRRDHFTS 130 P+GKR D+FTS Sbjct 191 PRGKRHDYFTS 201 > Gokush_Bourget_259_Microviridae_AG073_putative.VP1 Length=540 Score = 22.7 bits (47), Expect = 3.3, Method: Compositional matrix adjust. Identities = 20/71 (28%), Positives = 29/71 (41%), Gaps = 0/71 (0%) Query 119 LPKGKRRDHFTSLRITITAAGDMIIVIRQGCKPGAIMILQLQKTTVGPFAGILHPAANTL 178 L +GKR D+FTS G+ + + P + + + G AGI PA Sbjct 190 LRRGKRHDYFTSALPWPQKGGNAVTIPLGTRAPVYGVGVATATSGNGSTAGIKDPAGLNQ 249 Query 179 TTWDLNTFTNY 189 T + T T Y Sbjct 250 TWTNATTATPY 260 > Gokush_Bourget_248_Microviridae_AG0251_putative.VP1 Length=546 Score = 22.7 bits (47), Expect = 3.4, Method: Compositional matrix adjust. Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%) Query 119 LPKGKRRDHFTS 130 L +GKR+D+FTS Sbjct 188 LRRGKRKDYFTS 199 > Gokush_Bourget_504_Microviridae_AG0256_putative.VP1 Length=536 Score = 22.3 bits (46), Expect = 4.5, Method: Compositional matrix adjust. Identities = 7/10 (70%), Positives = 10/10 (100%), Gaps = 0/10 (0%) Query 121 KGKRRDHFTS 130 +GKR+D+FTS Sbjct 190 RGKRKDYFTS 199 > Gokush_gi|9634949|ref|NP_054647.1|_structural_protein_[Chlamydia_phage_2] Length=565 Score = 21.9 bits (45), Expect = 6.2, Method: Compositional matrix adjust. Identities = 8/12 (67%), Positives = 10/12 (83%), Gaps = 0/12 (0%) Query 119 LPKGKRRDHFTS 130 L +GKR D+FTS Sbjct 187 LKRGKRYDYFTS 198 > Gokush_gi|47566141|ref|YP_022479.1|_structural_protein_[Chlamydia_phage_3] Length=565 Score = 21.9 bits (45), Expect = 6.2, Method: Compositional matrix adjust. Identities = 8/12 (67%), Positives = 10/12 (83%), Gaps = 0/12 (0%) Query 119 LPKGKRRDHFTS 130 L +GKR D+FTS Sbjct 187 LKRGKRYDYFTS 198 > Gokush_gi|17402851|ref|NP_510872.1|_hypothetical_protein_PhiCPG1p2_[Guinea_pig_Chlamydia_phage] Length=553 Score = 21.9 bits (45), Expect = 6.4, Method: Compositional matrix adjust. Identities = 8/12 (67%), Positives = 10/12 (83%), Gaps = 0/12 (0%) Query 119 LPKGKRRDHFTS 130 L +GKR D+FTS Sbjct 187 LKRGKRYDYFTS 198 > Gokush_gi|77020115|ref|YP_338238.1|_putative_major_coat_protein_[Chlamydia_phage_4] Length=554 Score = 21.9 bits (45), Expect = 6.6, Method: Compositional matrix adjust. Identities = 8/12 (67%), Positives = 10/12 (83%), Gaps = 0/12 (0%) Query 119 LPKGKRRDHFTS 130 L +GKR D+FTS Sbjct 188 LKRGKRYDYFTS 199 Lambda K H a alpha 0.323 0.138 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 18503979