bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-25_CDS_annotation_glimmer3.pl_2_3 Length=54 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_A_047_Microviridae_AG0311_putative.VP1 19.6 3.0 Alpavirinae_Human_feces_A_048_Microviridae_AG087_putative.VP1 19.2 3.5 Alpavirinae_Human_feces_B_021_Microviridae_AG0368_putative.VP1 18.9 4.4 Alpavirinae_Human_feces_C_029_Microviridae_AG0109_putative.VP1 18.9 5.0 > Alpavirinae_Human_feces_A_047_Microviridae_AG0311_putative.VP1 Length=637 Score = 19.6 bits (39), Expect = 3.0, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 14/34 (41%), Gaps = 8/34 (24%) Query 11 IEPSFKAYVTEKHIKKTP--------HKNRVRRG 36 + P F ++ E HI P H NR + G Sbjct 71 VGPLFGSFKLEHHIYTIPFRLYNSWLHNNRTKIG 104 > Alpavirinae_Human_feces_A_048_Microviridae_AG087_putative.VP1 Length=650 Score = 19.2 bits (38), Expect = 3.5, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 14/34 (41%), Gaps = 8/34 (24%) Query 11 IEPSFKAYVTEKHIKKTP--------HKNRVRRG 36 + P F ++ E HI P H NR + G Sbjct 73 VGPLFGSFKHENHIFSVPLRLYNSWLHNNRTKIG 106 > Alpavirinae_Human_feces_B_021_Microviridae_AG0368_putative.VP1 Length=649 Score = 18.9 bits (37), Expect = 4.4, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 14/34 (41%), Gaps = 8/34 (24%) Query 11 IEPSFKAYVTEKHIKKTP--------HKNRVRRG 36 + P F ++ E HI P H NR + G Sbjct 73 VGPLFGSFKHENHIFSVPIRLYNSWLHNNRTKIG 106 > Alpavirinae_Human_feces_C_029_Microviridae_AG0109_putative.VP1 Length=640 Score = 18.9 bits (37), Expect = 5.0, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 14/34 (41%), Gaps = 8/34 (24%) Query 11 IEPSFKAYVTEKHIKKTP--------HKNRVRRG 36 + P F ++ E H+ P H NR + G Sbjct 71 VGPLFGSFKLEHHVYTVPFRLYNSWLHNNRTKIG 104 Lambda K H a alpha 0.320 0.128 0.374 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3709748