bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_7 Length=67 Score E Sequences producing significant alignments: (Bits) Value Gokush_gi|12085136|ref|NP_073538.1|_major_capsid_protein_[Bdell... 21.2 1.3 Gokush_Human_feces_A_013_Microviridae_AG011_putative.VP4 18.9 8.9 Gokush_SectLung2LLL_002_Microviridae_AG0242_putative.VP3 18.5 9.2 > Gokush_gi|12085136|ref|NP_073538.1|_major_capsid_protein_[Bdellovibrio_phage_phiMH2K] Length=533 Score = 21.2 bits (43), Expect = 1.3, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Query 35 LFHAVEYVSKHPLVKPCLNKYVIAS 59 ++H EY + VKP LNK I S Sbjct 469 VWHLAEYFT----VKPSLNKTFIES 489 > Gokush_Human_feces_A_013_Microviridae_AG011_putative.VP4 Length=330 Score = 18.9 bits (37), Expect = 8.9, Method: Composition-based stats. Identities = 6/38 (16%), Positives = 20/38 (53%), Gaps = 0/38 (0%) Query 7 VVVFAPKSPGLEHLSAVSLALDYRVGCTLFHAVEYVSK 44 V+ F P+ ++ ++L +GC + ++ ++ ++ Sbjct 23 VIKFHPRPDQMDKFEPIALPCGQCLGCRIEYSRQWANR 60 > Gokush_SectLung2LLL_002_Microviridae_AG0242_putative.VP3 Length=165 Score = 18.5 bits (36), Expect = 9.2, Method: Compositional matrix adjust. Identities = 6/15 (40%), Positives = 11/15 (73%), Gaps = 0/15 (0%) Query 49 KPCLNKYVIASLSFQ 63 K +NK ++A+ SF+ Sbjct 4 KDTINKPIVATRSFR 18 Lambda K H a alpha 0.324 0.137 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3642139