bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_3 Length=85 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_gut_22_017_Microviridae_AG0397_putative.VP1 20.8 2.4 Alpavirinae_Human_feces_A_033_Microviridae_AG0383_putative.VP1 19.6 7.7 Alpavirinae_Human_gut_32_012_Microviridae_AG0207_putative.VP2 19.6 7.9 Alpavirinae_Human_gut_31_126_Microviridae_AG0303_putative.VP2 19.6 7.9 > Alpavirinae_Human_gut_22_017_Microviridae_AG0397_putative.VP1 Length=607 Score = 20.8 bits (42), Expect = 2.4, Method: Composition-based stats. Identities = 15/47 (32%), Positives = 19/47 (40%), Gaps = 8/47 (17%) Query 14 KEWIKSAKIPFESFSEGSYALMWEGFEWDTGCVVKGFRVVMNCCLFK 60 K W+ ES G W GF + G V +VV+N FK Sbjct 525 KSWVSPVT---ESLLSG-----WFGFGYSEGDVNSQNKVVLNYKFFK 563 > Alpavirinae_Human_feces_A_033_Microviridae_AG0383_putative.VP1 Length=590 Score = 19.6 bits (39), Expect = 7.7, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 9/21 (43%), Gaps = 0/21 (0%) Query 30 GSYALMWEGFEWDTGCVVKGF 50 GSYA W F +GF Sbjct 242 GSYAFSWNFFTGRQSLFQRGF 262 > Alpavirinae_Human_gut_32_012_Microviridae_AG0207_putative.VP2 Length=364 Score = 19.6 bits (39), Expect = 7.9, Method: Composition-based stats. Identities = 8/13 (62%), Positives = 10/13 (77%), Gaps = 0/13 (0%) Query 66 ENELRKSRVILTK 78 EN+LRK R LT+ Sbjct 278 ENQLRKLRKALTQ 290 > Alpavirinae_Human_gut_31_126_Microviridae_AG0303_putative.VP2 Length=364 Score = 19.6 bits (39), Expect = 7.9, Method: Composition-based stats. Identities = 8/13 (62%), Positives = 10/13 (77%), Gaps = 0/13 (0%) Query 66 ENELRKSRVILTK 78 EN+LRK R LT+ Sbjct 278 ENQLRKLRKALTQ 290 Lambda K H a alpha 0.322 0.136 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3608121